SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|72162625|ref|YP_290282.1| from Thermobifida fusca YX

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|72162625|ref|YP_290282.1|
Domain Number 1 Region: 79-140
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000101
Family NfeD domain-like 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|72162625|ref|YP_290282.1|
Sequence length 146
Comment hypothetical protein Tfu_2226 [Thermobifida fusca YX]
Sequence
MSVWVVWLVLAVALGVAELFTLTLALGLIGAAALIAGVVGAFGVGLTGQVLVFAVASAAG
LLVVRPIARRHMTQPPPLRSGTEALVGRSALVVEEITATGGRIKLQGEEWSARCLDETLR
IPVGAHVDVMEIEGATAVVYPRDELP
Download sequence
Identical sequences Q47MR1
269800.Tfu_2226 WP_011292649.1.46431 WP_011292649.1.72373 WP_011292649.1.82272 gi|72162625|ref|YP_290282.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]