SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|72162782|ref|YP_290439.1| from Thermobifida fusca YX

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|72162782|ref|YP_290439.1|
Domain Number 1 Region: 52-240
Classification Level Classification E-value
Superfamily Sortase 6.28e-44
Family Sortase 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|72162782|ref|YP_290439.1|
Sequence length 262
Comment peptidase C60, sortase A and B [Thermobifida fusca YX]
Sequence
MVSTSRRPPSDRRRRSGRGRRRAPAPRSRVTIGDVVRVIFRTIGELLFTAGLIMLFFAAF
QIWGKQFQTDAEQERLEQAIAEVWEQGPDSEPLPGSANSRLYIPKTDQNWVVVSGVGPED
IKYGPGWYPESWTPEGMVPAARAGQPGNYAVAGHRVAAVFWDLDKLEEGDELVLEDAENF
YTYQVVESKVVLPNAIEVIAPDPFNPESTEEPEKAYLTLTTCHPKLQNSHRLIVHAELVD
TRPKERGMPDNIAHMAPENEEG
Download sequence
Identical sequences Q47MA6
269800.Tfu_2383 WP_011292806.1.46431 WP_011292806.1.72373 WP_011292806.1.82272 gi|72162782|ref|YP_290439.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]