SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|72161188|ref|YP_288845.1| from Thermobifida fusca YX

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|72161188|ref|YP_288845.1|
Domain Number 1 Region: 5-150
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.82e-46
Family Ribonuclease PH domain 1-like 0.000000195
Further Details:      
 
Domain Number 2 Region: 318-510
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.54e-43
Family Ribonuclease PH domain 1-like 0.000000829
Further Details:      
 
Domain Number 3 Region: 151-260
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.31e-27
Family Ribonuclease PH domain 2-like 0.00000635
Further Details:      
 
Domain Number 4 Region: 473-567
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 6.34e-25
Family Ribonuclease PH domain 2-like 0.0000261
Further Details:      
 
Domain Number 5 Region: 571-683
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.98e-20
Family Eukaryotic type KH-domain (KH-domain type I) 0.0038
Further Details:      
 
Domain Number 6 Region: 264-343
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 3.4e-18
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0000626
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|72161188|ref|YP_288845.1|
Sequence length 767
Comment polynucleotide phosphorylase [Thermobifida fusca YX]
Sequence
MEGVYSAEAVIDNGRFGTRTIRFETGRLARQATGSATAYLDDETMVLSATTVSKRPKEAL
DFFPLTVDVEERMYAAGRIPGSFFRREGRPSEDAILTCRLIDRPLRPSFQKGLRNEIQIV
ATVLALHPDHLYDVIAINAASMSTQLAGLPFSGPIGGVRVALVEGQWVAFPTHSELANAT
FDMVVAGRVLDNGDVAIMMVEAESTPHTLRLVAEGAIGPNEQTVAEGLEAAKPFIKVLCR
AQQTVAEAAGKPPGEYPIFIDYQDDAYAAVEEAIHDELAAALTIADKQEREAELDRVKAL
VAEKLAEDFEGREKELAAAFRALTRKLVRERIVKDGVRIDGRGVKDIRSLTAEVNVIPRV
HGSALFERGETQILGITTLNMLRMEQTIDTLNPERTKRYMHNYNFPPYSTGETGRVGAPK
RREIGHGALAERALVPVLPSREEFPYAIRQVSEAIGSNGSTSMGSVCASTMSLMAAGVPL
KDMVAGIAMGLIYEDGKYVTLTDILGAEDAYGDMDFKVAGTRDLITALQLDTKLDGIPAE
VLASALQQARGARLAILDVMSEAINRPAEISPHAPRILTVKVPIDKIGEVIGPKGKMINS
IQDETGAEITIEDDGTIYIGATDGPSAEAARDAINSIANPTMPEVGERYLGTVVKTTAFG
AFVSLLPGKDGLLHISQIRKMHGGQRIENVEDVISIGEKIHVEVRDIDERGKLSLVPVEV
IEAEAVAAPNGGESPNGAKKTDASGNGAKQPRRRRRTRSSSRSSENT
Download sequence
Identical sequences Q47RU5
269800.Tfu_0784 WP_011291231.1.82272 gi|72161188|ref|YP_288845.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]