SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000000100 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000000100
Domain Number 1 Region: 687-1043
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 4.05e-112
Family Hect, E3 ligase catalytic domain 0.000000155
Further Details:      
 
Domain Number 2 Region: 2-380
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 1.31e-101
Family Regulator of chromosome condensation RCC1 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000000100   Gene: ENSOARG00000000117   Transcript: ENSOART00000000125
Sequence length 1050
Comment pep:known_by_projection chromosome:Oar_v3.1:6:36005466:36125662:-1 gene:ENSOARG00000000117 transcript:ENSOART00000000125 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLCWGYWSLGQPGISPNLQGVVAEPQVCGFISDRSVKEVACGGNHSVFLLEDGEVYTCGA
NTKGQLGHEREGNKPEQIGALADQHIVHVACGESHSLALSDQGQLFSWGAGSDGQLGLMT
TEDSVAVPRLIQKLNQQTILQVSCGNWHCLALAADGQFFTWGRNSHGQLGLGKEFPSQAS
PQRVRSLEGIPLAQVVAGGAHSFALSLSGAVFGWGMNNAGQLGLSDEKDRESPCHVKLLR
TQKVVYISCGEEHTAVLTKSGGVFTFGAGSCGQLGHDSMNDEVNPRRVLELMGSEVTQIA
CGRQHTLAFVPSSGLIYAFGCGARGQLGTGHTCNVKCPSPVKGYWAAHSGQLSARADRFK
YHIVKQIFSGGDQTFVLCSKYENSSPAVDFRTMNQAHYTSLINDETIAVWRQKLSEHNNA
NTINGVVQILSSAACWNGSFLEKKIDEHFKTSPKIPGIDLNSTRVLFEKLMNSQHSMILE
QILNSFESCLIPQLSSSPPDVEAMRIYLILPEFPLLQDSKYYITLTIPLAMAILRLDTNP
SKVLDNWWSQVCPKYFTKLVNLYKGAVVYLLRGRKTFLIPVLFNNYITAALKLLEKLYKV
NLKVKHVEYDAFYIPEISSLVDIQEDYLMWFLHQAGMKARPSIMQDAVTLCSYPFIFDAQ
AKTKMLQTDAELQMQVAVNGANLQNVFMLLTLEPLLARSPFLVLHVRRSNLVGDALRELS
IHSDIDLKKPLKVIFDGEEAVDAGGVTKEFFLLLLKELLNPIYGMFTYYQDSNLLWFSDT
CFVEHNWFHLIGITCGLAIYNSTVVDLHFPLALYKKLLNVKPGLEDLKELSPTEGRSLQE
LLDYPGEDIEETFCLNFTICRESYGVIEQKKLIPGGDKVAVCKENRQEFVDAYVNYVFQI
SIHEWYTAFSSGFLKVCGGKVLELFQPSELRAMMVGNSSYNWEELEETAIYKGDYSATHP
TVKLFWETFHEFPLEKKKKFLLFLTGSDRIPIYGMASLQIVIQSTASGEEYLPVAHTCYN
LLDLPKYSSKEVLRARLTQALDNYEGFSLA
Download sequence
Identical sequences W5NPL0
ENSOARP00000000100 XP_004009758.1.66739 XP_012035077.1.66739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]