SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000000143 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000000143
Domain Number 1 Region: 24-106
Classification Level Classification E-value
Superfamily Snake toxin-like 0.00000000352
Family Extracellular domain of cell surface receptors 0.085
Further Details:      
 
Domain Number 2 Region: 120-185
Classification Level Classification E-value
Superfamily Snake toxin-like 0.0000000173
Family Extracellular domain of cell surface receptors 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000000143   Gene: ENSOARG00000000162   Transcript: ENSOART00000000168
Sequence length 198
Comment pep:novel scaffold:Oar_v3.1:JH921914.1:7036:11102:-1 gene:ENSOARG00000000162 transcript:ENSOART00000000168 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKPSMKPETFLLASALLYTLLGLGYPLSCEVCVGDGPSCTGKLQTCAPDEDSCIIVVTET
NRKASLAVTSYKGCAKSSECESGLFGITMNPENYMGSRRRCATGLCPALSQAFVRNHTEN
GLRCPSCIAAFTETCTASEEALCVGEETRCVAVSGLVQPAGVKFAVRGCGMETACHTKPG
TLVPSGARLFTIKKTSCL
Download sequence
Identical sequences W5NPQ3
ENSOARP00000000143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]