SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000000271 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000000271
Domain Number 1 Region: 1-58
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 8.63e-24
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000000271   Gene: ENSOARG00000000282   Transcript: ENSOART00000000297
Sequence length 131
Comment pep:novel chromosome:Oar_v3.1:14:57830468:57833314:1 gene:ENSOARG00000000282 transcript:ENSOART00000000297 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QGRLRFQDVAIDFTLEEWECLDLGQRELYRDVMLENYGNLASLGLVVSKPDLVTFLEKMR
DPQDVRGIETTAIHPEFLDNDTQGLMPKNPGLEDVFPKANLEINERFHLGNLHLMKDWEY
TRACEIQRGCL
Download sequence
Identical sequences W5NQ31
ENSOARP00000000271

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]