SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000000302 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000000302
Domain Number 1 Region: 24-266,306-381,497-547
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.4e-66
Family FAD-linked reductases, N-terminal domain 0.0022
Further Details:      
 
Domain Number 2 Region: 361-484
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 9.16e-31
Family L-aminoacid/polyamine oxidase 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000000302   Gene: ENSOARG00000000307   Transcript: ENSOART00000000328
Sequence length 555
Comment pep:known_by_projection chromosome:Oar_v3.1:13:50288586:50301291:-1 gene:ENSOARG00000000307 transcript:ENSOART00000000328 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQSCESSGDSADDPLSRGLRRRGQPRVVVIGAGLAGLAAAKALLEQGFTDVTVLEASSRI
GGRVQSVKLGHATFELGATWIHGSHGNPVYHLAEANGLLEETTDGERSVGRISLYSKNGV
ACYLTNRGCRIPKDVVEEFSDLYNEVYNLTQEFFRHGKPVNAESQNSVGVFTREEVRNRI
RDDPDDPEATKRLKLAMIQQYLKVESCESSSHSMDEVSLSAFGEWTEIPGAHHVIPSGFM
RVVELLAEGLPAHVIQLGKPVRCVHWDQASSRPRGPEIEPRDEGDHNHDAGEGSQGGEEP
REERQDEDEQWPVVVECEDCEVIPADHVIVTVSLGVLKRQHASFFRPGLPAEKVAAIHRL
GIGTTDKIFLEFEEPFWGPECNSLRFVWEDEAESCTLTYPPELWYRKICGFDVLYPPERY
GHVLSGWICGEEALVMEKCDDEAVAEICTEMLRQFTGNPNIPKPRRILRSAWGSNPYFRG
SYSYTQVGSSGADVEKLAKPLPYTESSKTAPMQVLFSGEATHRKYYSTTHGALLSGQREA
ARLIEMYRDLFQQGT
Download sequence
Identical sequences W5NQ62
XP_004014405.1.66739 XP_017912868.1.57651 ENSOARP00000000302

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]