SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000000329 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000000329
Domain Number 1 Region: 229-440
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 6.83e-59
Family Reprolysin-like 0.00096
Further Details:      
 
Domain Number 2 Region: 527-575
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000785
Family TSP-1 type 1 repeat 0.00061
Further Details:      
 
Domain Number 3 Region: 932-982
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000471
Family TSP-1 type 1 repeat 0.0024
Further Details:      
 
Domain Number 4 Region: 1480-1540
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000144
Family TSP-1 type 1 repeat 0.0031
Further Details:      
 
Domain Number 5 Region: 1430-1482
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000112
Family TSP-1 type 1 repeat 0.0041
Further Details:      
 
Domain Number 6 Region: 809-867
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000981
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 
Domain Number 7 Region: 1343-1376
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000129
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000000329   Gene: ENSOARG00000000333   Transcript: ENSOART00000000355
Sequence length 1596
Comment pep:known_by_projection chromosome:Oar_v3.1:18:29375835:29423578:1 gene:ENSOARG00000000333 transcript:ENSOART00000000355 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IHRIGPQRPLGLLGSHSVSALLPAGHAAEGRAALDIVHPVRVDSGGSFLSYELWPRALRK
RDLSARPSAPTFYELQYRGRELRFNLTTNPHLLAPGFVSETRRRGGMGRGATPIATPCLA
TDLSAGFGPLEFPLPASAISTCKGLRKGVFQLSNEDYFIEPLDGVPARPGHAQPHVVYKR
QAPEKWAEPGDSRAPGTCGVKEFPELEPQRERWEQRRQRLRRRYQRSVSKEKWVETLVVA
DAKMVEHHGQPDVESYVLTIMNMVAGLFHDPSIGNPIHITIVRLILLEDEEEDLKISHHA
DNTLRSFCKWQKSINMKGDAHPLHHDTAILLTRKDLCAAMNQPCETLGLSHVAGMCQPHR
SCNINEDTGLPLAFTVAHELGHSFGIQHDGSGNDCEPVGKRPFIMSPQLLYDAAPLTWSR
CSREYITRFLDRGWGLCLDDSPAKDVIDFPSIPPGVLYDVGHQCRLQYGAYSAFCDDMDN
VCHTLWCSVGTTCHSKLDAAVDGTSCGESKWCLNGECVPVGFQPEAVDGGWSGWSAWSLC
SRSCGVGVQSAERQCTQPVPKYKGKYCVGERKRLRPRAPPPSPKPQASHFDAMLYKGQLH
TWVPVVNDGSWGQPCRHYQPSGAPRQYFAEKLRDAVVDGTPCYQGQGSRDLCINGICKNV
GCDFEIDSGAVEDRCGVCHGNGSTCHTVSGTFEEAEGLGYVDVGLIPVGAREIRIVEVAE
AANFLALRSEDPDKYFLNGGWTIQWNGDYEVAGTTFTYARTGNWENLTSPGPTDEPVWIQ
LLFQESNPGVRYEYIIHREADGHDHIQQPEFSWRYGPWSKCTVTCGTDVKRQGVLCTERQ
AGPVDERHCDPLDRPDDRQRKCGEEPCPARWWAGEWQGGSPPSWRGGLPRRAVLCIRSVG
LDEQRALEPPACEHLPRPPAETPCNRDVPCPATWAVGNWSECSVTCGPGTQRRSILCIND
TGVPCDEAQQPAREAPCLLPPCPQGLDTLGPEGSGSGSFSPELFNEVDFIPGHLAPRPPP
PSSPEPAGMGNAIEEEGRELGLPGPVFVDDFYYDYNFINFHEDLSYGPFEDPDSDLVGTG
DWRPPPPSTAAEPPTGTPVPPTEPPGTQDEGAGRWVPYPFTQPAGSQNQFLGAEGSQSLP
PAPRWERTNEVSDDEEALGHGDPRPPQRPSPTSPSPSSAGTTHSSPSPHTVELWTSGMVA
WEPALEGGLGPLDSELWPTMRGAPPLPPPTATLPDTQGTDSPLELGTATLSTPGLALQDL
QTLAMPGNFLLMAPTGLGHIPWVTPQSLGPLGQPDPPSSKMPPSPGLLSTPAQDRPANSS
RAPGPLDTSPVEEGFPVNLLPARNASWEVGNWSQCSTTCGLGAVWRLVRCSSGREEDCAP
AGRPQPARRPHLRLVWEGSPMLAPTSAGPLRPFPCQLGPTKPPARRPCGAQPCLSWYTSS
WRECSEACGGGEQQRLVTCPEPGLCEEALRPNSTRSCNTHPCTQWVVGPWGQCSAPCGGG
VQRRLVKCVNTQTGLPEEDSDLCGHEAWPESSRPCGTQDCELTEPPRCERDRLSFGFCET
LRLLGRCQLPTVRAQCCRSCPPPGVPSRGHQRVARR
Download sequence
Identical sequences W5NQ89
ENSOARP00000000329

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]