SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000000376 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000000376
Domain Number 1 Region: 558-668
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.62e-24
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 2 Region: 376-497
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.96e-17
Family Spermadhesin, CUB domain 0.0035
Further Details:      
 
Domain Number 3 Region: 675-740
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000723
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 4 Region: 803-862
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000616
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 5 Region: 734-795
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000108
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 6 Region: 211-318
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000432
Family Spermadhesin, CUB domain 0.0039
Further Details:      
 
Domain Number 7 Region: 322-383
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000389
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 8 Region: 497-561
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000054
Family Complement control module/SCR domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000000376   Gene: ENSOARG00000000375   Transcript: ENSOART00000000404
Sequence length 955
Comment pep:known_by_projection chromosome:Oar_v3.1:17:65698820:65765918:1 gene:ENSOARG00000000375 transcript:ENSOART00000000404 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DEPPEGDAGQSDTYLLPSEILGSSSLSKENPEESVTTAPLNPVQSGDELREPELEGTVPF
APQDPAAVSTLLPLPEEPGTRHAFPARKKPPSLKQVNLARKQLRPKATLAAATQRTASPG
PGLLAAAPGKPRPPGGQPGRPPPPRDPPTGGAAAVPEEAPEAPLEDASPETLTDKGETEL
TGSASEESQETTTSTIITTTVITTEQAPAVCSVSFSDPEGYIDSSDYPPLPLHNFLECTY
NATVYTGYGVELQVKSVNLSEGELLSIRGVDGPSLTVLANHTLLVEGQVIRSPTNTISVY
FRTFQDDGLGTFQLHYQAFMLSCSFPRRPDFGDVTVMDLHSGGEAHFHCHLGYELQGAKT
LTCINASKPHWSSREPICSAPCGGAVHNATIGRVLSPSHSANASGSQFCVWTIEAPEGQK
LHLHFERLALHEKDRMMVYSGLTNKSTLLYDSFQTENVPFEGLLSDGHTIRIEFTSHQPP
AASAFNIRFEAFEKGHCYEPYIQNGNFTTSDPTYNIGTVVEFTCDPGHSLEQGPAIIECI
NVRDPYWNDTEPLCRAMCGGELSAVAGVVLSPNWPEPYVEGEDCIWKIHVGEEKRIFLDI
QFLNLSNSDILTIYDGDEVMPHILGQYLGNSGPQKLYSSTPDLTIQFHSDPAGLIFGKGQ
GFIMNYIEVSRNDSCPDLPEIQNGWKTTSHTELVRGARITYQCDPGYDIVGSDTLTCQWD
LSWSSDPPFCEKIMYCTDPGEVDHSTRLISDPVLLVGTTIQYTCNPGFVLEGSSLLTCYS
RETGSPIWTSRLPHCAVPEESLACDNPGLPENGYQILYKRLYLPGESLTFMCYEGFELMG
EVTIRCILGQPSHWSGPLPVCKVNQDSFEHALEVAEAAAETSLEGGNMALAIFIPVLIIS
LLLGGAYIYITRCRYYSNLRLPLMYSHPYSQITVETEFDNPIYETGETREYEVSI
Download sequence
Identical sequences W5NQD6
ENSOARP00000000376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]