SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000000402 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000000402
Domain Number 1 Region: 601-781
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 5.49e-48
Family Ypt/Rab-GAP domain of gyp1p 0.0026
Further Details:      
 
Domain Number 2 Region: 759-872
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 9.68e-28
Family Ypt/Rab-GAP domain of gyp1p 0.0069
Further Details:      
 
Domain Number 3 Region: 2-109
Classification Level Classification E-value
Superfamily PH domain-like 3.56e-17
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 
Weak hits

Sequence:  ENSOARP00000000402
Domain Number - Region: 210-236
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0144
Family KRAB domain (Kruppel-associated box) 0.0049
Further Details:      
 
Domain Number - Region: 456-502
Classification Level Classification E-value
Superfamily C-terminal domain of PLC-beta 0.0994
Family C-terminal domain of PLC-beta 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000000402   Gene: ENSOARG00000000399   Transcript: ENSOART00000000430
Sequence length 923
Comment pep:known_by_projection chromosome:Oar_v3.1:18:29428283:29515082:-1 gene:ENSOARG00000000399 transcript:ENSOART00000000430 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LCGYLQKLSGKGPLRGYRNRWFVFDARRCYLYYFKSPQDALPLGHLDIADACFSYSGPDE
AAEPGAEPPAHFQVHSGGAVTVLKAPNRQLMTYWLQELQQKRWEYCNSLDMVKWDSRTSP
TPGDFSQGLVARDNTDLINLHSNASAEKARNVLAVEAAPGELVGEQAANQPAPGPPNSIN
FSFKQWGTELRNSMSSFRPGRGHNDSRRSVFYTSEEWELLDPSPKELEESMVQEERKKQT
PEGNKGITGSGFPFDFGRIPYKGRRPLKEMIGSYKNRHSLGDPSPEVPSGSGSASKPASE
MQLLVQNQQEELERLRKDLASQKELVRLLQQTVRSSQYDKYFASSRLCDGVPQDTLGLLH
QKDDQILGLTNQLERFNQEKDSLQQEVRMLKSKVGELSERLGMLMETIQAKDEVIMKLSR
QLSECEGSASSPTCVPGSPAAAPTGRDQLELDWLKDNLQGYKTQNKFLNKEILELAALRR
NAERRERDLMAKYSSLEAKLCQIESKYLILLQEMKTPVCSEEQGPARDVIAQLLEDALQV
ESPEHPEQAFIKPHLVSEYDIYGFKTVPEDDEEEKLVAKVRALDLKTLYLTENQEVSTGV
KWENYFASTVNREMTCSPELKNLVRAGIPHEHRSKVWKWCVDRHIKKFKDSTQPGYFQTL
LQKALEKQNPASKQIELDLLRTLPNNKHYSCPTSEGIQKLRNVLLAFSWRNPDIGYCQGL
NRLVAVALLYLEQEDAFWCLVTIVEVFMPRDYYTKTLLGSQVDQRVFRDLMSEKLPRLHA
HFEQYKVDYTLITFNWFLVVFVDSVVSDILFKIWDSFLYEGPKVIFRFALALFKYKEEEI
LKLQDSMSIFKYLRYFTRTILDARKLIGISFGDLNPFRSGRAYHLEKVRLELTELEAIRE
DFLRERDTSPDKGELVSDEEEDT
Download sequence
Identical sequences W5NQG2
ENSOARP00000000402

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]