SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000000417 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSOARP00000000417
Domain Number - Region: 17-67
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.068
Family FCH domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000000417   Gene: ENSOARG00000000419   Transcript: ENSOART00000000445
Sequence length 112
Comment pep:novel scaffold:Oar_v3.1:JH922622.1:2255:5396:1 gene:ENSOARG00000000419 transcript:ENSOART00000000445 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMVGGAAQQAALACYRQELSFCQEQVEQMARERDKARQDLEKAEQRNLEFVKETDDLHSA
LEQLAEEKVRWVLLGSWARVDGGHRLLPAEALLSHLSPQQGSRRPGITHVVG
Download sequence
Identical sequences W5NQH7
XP_011963464.1.66739 ENSOARP00000000417

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]