SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000000421 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000000421
Domain Number 1 Region: 1040-1122
Classification Level Classification E-value
Superfamily Immunoglobulin 2.23e-22
Family I set domains 0.014
Further Details:      
 
Domain Number 2 Region: 1125-1212
Classification Level Classification E-value
Superfamily Immunoglobulin 8.5e-18
Family I set domains 0.039
Further Details:      
 
Domain Number 3 Region: 907-987
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000141
Family I set domains 0.022
Further Details:      
 
Domain Number 4 Region: 737-804
Classification Level Classification E-value
Superfamily BPTI-like 0.000000000000184
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0018
Further Details:      
 
Domain Number 5 Region: 361-422
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000235
Family TSP-1 type 1 repeat 0.0022
Further Details:      
 
Domain Number 6 Region: 300-349
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000353
Family TSP-1 type 1 repeat 0.0051
Further Details:      
 
Domain Number 7 Region: 421-478
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000654
Family TSP-1 type 1 repeat 0.0037
Further Details:      
 
Domain Number 8 Region: 482-536
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000157
Family TSP-1 type 1 repeat 0.0042
Further Details:      
 
Domain Number 9 Region: 26-61
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000589
Family TSP-1 type 1 repeat 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000000421   Gene: ENSOARG00000000412   Transcript: ENSOART00000000449
Sequence length 1271
Comment pep:known_by_projection chromosome:Oar_v3.1:7:81614733:81646466:1 gene:ENSOARG00000000412 transcript:ENSOART00000000449 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLLLLLPLLLAPAPGSSAPQVRRQSDTWGSWGNWSPCSRTCGGGVSFRERPCYTQSTDV
SHSKISGAGSHALGNFEEGVVHFIEKILSPCDGGGILSHRGFPLLLTAAPNKCELNCIPK
GESFYYKHKEAVVDGTPCEPGKRDICVDGSCRVVGCDHHLDSSKEEDKCLRCGGDGTTCY
PVTGVFEANDLSRGYNQILIVPMGATSIRIEEAAASRNFLGAVKSIRGEYYLNGHWTIEG
ARALPVASTLLHYERGAEGDLAPERLHARGPTSEPLVIELISQEPNPGVHFEYHLPLGAP
RPGFSWSHSSWGDCSAECGGGQQTRQVFCTVDDEVYPEHLCQPQPRPADRRPPHKPSGTR
AQCWKTGPWTLCSASCGGGSQSRSVYCVSSDGASAQEAAEDAECEGLPEKPPGTQACNLQ
RCAGWSVEPWSECSVSCGVGVRRRSVTCRGDEGSLLHATACSSEDRPLLTEPCVHDDCPP
LSDQAWHVGAWGLCSKSCSSGTRRRQVVCALGAPSRCGSLQLSKPAAVEACNTQPCDLPP
EVPSMPEVHTSPRDPRMSLGPREASASDFRDQWWAPQEQPSARGNPRGDQSPPLSAPGPA
PSLQLSSYQPGSGPRDCRQSSHGCCPDGHTASLGPQWQGCPGASSCQQSRFGCCPDGVTV
AEGPHQAGCMSSYGRDNSGGRPGSRAAASAVPSAHRPQAQQKEPSECRGSQFGCCYDHVA
SALGPLGEGCVGQPSSAYPVQCLLPSAHGSCTDWAARWYFVPSVGQCNRFCSVGRCTRFW
YGGCHGNANNFASEEECVSACRGPQPGAGASGQSTHGDGGGSSPGGQQAASRHGPGPMVQ
RGPLPSGGLRWQDQEPGPGVMDHRPAFGEGPWDQETGSSPPGLSGDAGRPAPPSRGSSYR
VTLAGSEPSVVQAALGQLVRLFCPERGSPDPHSRWQKDGQPISSDRHQLQSDGSLVIRPL
RAEDAGIYSCGGPGPDHHSQQVQLRITGGDVAVPSEAEPRHFPETRDPAQDYSPGDPSRE
RPAAASHPWPLTRVRLDRSQPGVLDAQPGQRVRLTCRAEGFPPPTIEWQRDGQPLSSPRH
QLQSDGSLVISRVAVEDGGFYTCVAFNGHDRDQRWVQLRVLGELTITGLPSTMAVPEGDT
ARLLCVVPGESVNIRWSRNGLPVRADGHRVYQSPDGTLLIHNLRARDEGSYTCSAYRGSQ
AVSHPTKLLVFGSWPLLAAQPQDRSRDCVDQPELANCDLVLQARLCGNEYYSSFCCASCS
RVQAPMQPVWQ
Download sequence
Identical sequences W5NQI1
ENSOARP00000000421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]