SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000000543 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000000543
Domain Number 1 Region: 691-1035
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 2.75e-102
Family Hect, E3 ligase catalytic domain 0.00000118
Further Details:      
 
Domain Number 2 Region: 100-365
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 1.83e-69
Family Regulator of chromosome condensation RCC1 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000000543   Gene: ENSOARG00000000530   Transcript: ENSOART00000000572
Sequence length 1039
Comment pep:known_by_projection chromosome:Oar_v3.1:6:36197433:36244296:-1 gene:ENSOARG00000000530 transcript:ENSOART00000000572 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGRPRRRSRGGARPVSGRVPESRPSASRPSASRPSATAPAESWGAKLWLFPSAAGLRSA
LSKRPEATRQMCCTRRRLAVLERGGAGVEVHQLPAGSDGARKPKCIKLGKKMKIHSMDQG
EEHMLVLSSDGKPFEYKYSIEHARFQCILQEKNIIQITCGDYHSLALSKGGELFAWGQNL
DGQLGVGRIFASTSTPEIVENLSGVPLVQISAGEAHSMALSMSGNVYSWGRNDCGQLGLG
HTYNKDSPSCIEALDDQKVEFLACGGSHTALLTKSGLVFTFGDGKYGQLGHNSTQNELRP
CLVAGLVGNRVTQIACGRQHTLAYVSDMGKVFSFGSGKEGQLGNGGTCNQLMPRPMKLPS
SEELKSESSTSVKELIMVAGGNQSILMWMEKENSYVNLRRKIPTLNEGTVKRWIADVGTK
QWQNTKREIREIFSSPACLTGSFLRERIDGEMISIHLDLNAARNTFKELTQKDWITNTVI
TSCLRDNLLKNLPFNSPHQEALEVFFLLPECPVMHDSNNWESLVVPFAEAVNKMNNQMSR
VLEEYWASLKESPFINLVQMFKRAIVAQLHYWTESSENNNHIKALLEVLKKLYRVNQTKC
QLPENIFEINELTQWLDFYVDAYRRSSWKVDSDISVDIEYPVIFSRFPFIFNILSKIKLL
YADSLLKVQEKKFQACMRLAGIVDQEGSALSLLPTFNLIVRRSHLIEDVFNQLNQFENED
LRRELMVSFSGEIGYDFGGVRAEFFYCLFQEMTRPEYGMFTYPEEASYMWFPVRPKFEKK
SYFFFGLLCGLSLFNCNVADIPFPLALFKKLLDQTPSLEDLKELSPVLGESLQTLLDDDG
DDLEEVFHIHFNVHWDKNDVDLIPDGSHIIVDQTNKRDYVSKYVNYIFNISVKAVYEEFQ
RGFYKVCDKEIIEFFHPEQLKDVIIGNTDYDWETFEKNAHYEHGYDSSHPTIVMFWKALH
KLTLEEKKKFLVFLTGTDRIQVKGVKNMKITFCCPETLNEKDPIRAQTCFSVLYLPKYST
MERVEEALQVAINNSRGFG
Download sequence
Identical sequences W5NQV3
ENSOARP00000000543

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]