SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000000551 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000000551
Domain Number 1 Region: 19-130
Classification Level Classification E-value
Superfamily Lysozyme-like 2.68e-45
Family C-type lysozyme 0.00000519
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000000551   Gene: ENSOARG00000000543   Transcript: ENSOART00000000580
Sequence length 137
Comment pep:novel scaffold:Oar_v3.1:JH921983.1:4318:11670:-1 gene:ENSOARG00000000543 transcript:ENSOART00000000580 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKAVLILGLLLLSVTVQGKKFQKCELARTLKRLGLDGYKGFSLAKWMCLARWESNYNTRA
TNYNRGDKSTDYGIFQINSRWWCNDGKTPRAVNACRIPCSDLLKDDITQAVASAKKVVSD
PQDVRAWYVFFPPFQFY
Download sequence
Identical sequences W5NQW1
ENSOARP00000000551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]