SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000000601 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000000601
Domain Number 1 Region: 770-848
Classification Level Classification E-value
Superfamily DEATH domain 3.7e-19
Family DEATH domain, DD 0.0000628
Further Details:      
 
Domain Number 2 Region: 81-172
Classification Level Classification E-value
Superfamily Immunoglobulin 3.86e-16
Family I set domains 0.017
Further Details:      
 
Domain Number 3 Region: 171-221
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000157
Family TSP-1 type 1 repeat 0.00054
Further Details:      
 
Domain Number 4 Region: 227-274
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000144
Family TSP-1 type 1 repeat 0.00085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000000601   Gene: ENSOARG00000000586   Transcript: ENSOART00000000631
Sequence length 873
Comment pep:known_by_projection chromosome:Oar_v3.1:26:29727217:30003578:1 gene:ENSOARG00000000586 transcript:ENSOART00000000631 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQIFFKCNGEWVHQNEHVSEESLDESSGLKVREVFINVTRQQVEDFHGPEDYWCQCVAWS
HLGTSKSRKASVRIAYLRKNFEQDPQGREVPIEGMIVLHCRPPEGVPAAEVEWLKNEEPI
DSEQDEHIDTRADHNLIIRQARLSDSGNYTCMAANIVAKRRSLSATVVVYVNGGWSSWTE
WSACNVPCGRGWQKRSRTCTNPAPLNGGAFCEGMSVQKITCTALCPVDGSWEVWSEWSVC
SPECEHLRIRECTAPAPRNGGKFCEGLSQESENCTDGLCILDKKPLHEIKPQSIENASDI
ALYSGLGAAVVAVAVLVIGITLYRRSQSDYGVDVIDSSALTGGFQTFNFKTVRQGNSLLL
NPSMQPDLTVSRTYSGPICLQDPLDKELMTESSLFNPLSDIKVKVQSSFMVSLGVSERAE
YHGKNHSGTFPHGNNRSFTTVHARNKTPYIQNLSSLPTRTELRTTGVFGHLGGRLVMPNT
GVSLLIPHGAIPEENSWEIYMSINQGEPSLQSDGSEVLLSPEVTCGPPDMIVTTPFALTI
PHCADVSSEHWNIHLKKRTQQGKWEEVMSVEDESTSCYCLLDPFACHVLLDSFGTYALTG
EPITDCAVKQLKVAVFGCLSCNSLDYNLRVYCVDNTPWAFQEVVSDERHQGGQLLEEPKL
LHFKGNTFSLQISVLDIPPFLWRIKPFTACQEVPFSRVWCSNRQPLHCAFSLERYTPTTT
QLSCKICIRQLKGHEQILQVQTSILESERETITFFAQEDSTFPAQTGPKAFKIPYSIRQR
ICATFDTPNAKGKDWQMLAQKNSINRNLSYFATQSSPSAVILNLWEARHQHDGDLDSLAC
ALEEIGRTHTKLSNIAESQLDEADFNYSRQNGL
Download sequence
Identical sequences W5NR11
ENSOARP00000000601

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]