SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000000680 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000000680
Domain Number 1 Region: 132-188
Classification Level Classification E-value
Superfamily F-box domain 0.00000343
Family F-box domain 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000000680   Gene: ENSOARG00000000667   Transcript: ENSOART00000000712
Sequence length 376
Comment pep:known_by_projection chromosome:Oar_v3.1:12:116218:131222:1 gene:ENSOARG00000000667 transcript:ENSOART00000000712 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARGPGPLTRPRPDTVAMPKRGKRLKFRAQDACSGRVTVADYANSDPAVVRSGRVKKAVA
NAVQQEVKSLCGLEASQVPAVEALSGAGEPCDIIDSSGETDAQEESIHERTISRKKKSKR
HREDLNGTGGEEYPMDIWLLLASYIRPEDIVNFSLICKNAWTVTCTAAFWTRLYRRHYTL
DASLPLRLRPESMEKLHCLRACVIRSLYHMYEPFAARISKNPAIPESTPSTLKNSKCLLF
WCRKIVGNRQEPMWEFNFKFKKQSPRLKSKCMGGLQPPIQYEDVHTNPDQDCCLLQVTTL
NFIFIPIVMGMIFTLFTISVSTDMRHHRVRLVFQDYPVHGGQKLRSEQGVQVILDPVHSV
RLFDWWHPQYPSSLRA
Download sequence
Identical sequences W5NR90
ENSOARP00000000680 XP_004013586.1.66739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]