SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000000717 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000000717
Domain Number 1 Region: 98-219
Classification Level Classification E-value
Superfamily Troponin coil-coiled subunits 1.09e-29
Family Troponin T 0.0000456
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000000717   Gene: ENSOARG00000000697   Transcript: ENSOART00000000749
Sequence length 223
Comment pep:known_by_projection scaffold:Oar_v3.1:JH922959.1:17616:26464:1 gene:ENSOARG00000000697 transcript:ENSOART00000000749 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RLTAPKIPEGEKVDFDDIQKKRQNKDLMELQALIDSHFEARKKEEEELVALKERIKVPSP
SRSSTAALRSWLGRSSTAALRSWLGRSSTAALRSWLGAKRRAEDDLKKKKALSSMGANYS
SYLAKADQKRGKKQTARETKKKVLAERRKPLNIDHLSEDKLRDKAKELWDTLYKLETDKF
EYGEKLKRQKYDIMNVRARVEMLAKFSKKAGTTPKGKVGGRWK
Download sequence
Identical sequences W5NRC7
ENSOARP00000000717

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]