SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000000786 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000000786
Domain Number 1 Region: 78-153
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 1.01e-31
Family Skp1 dimerisation domain-like 0.00000694
Further Details:      
 
Domain Number 2 Region: 3-61
Classification Level Classification E-value
Superfamily POZ domain 0.00000000000000981
Family BTB/POZ domain 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000000786   Gene: ENSOARG00000000764   Transcript: ENSOART00000000818
Sequence length 156
Comment pep:known chromosome:Oar_v3.1:7:31144737:31145207:1 gene:ENSOARG00000000764 transcript:ENSOART00000000818 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSVTLQSSDGGIFEVDVEIAQQSVTIKTMLEDLGMDDEGDDDPVLKKAIQRCTHHRDDP
PPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILGANYLDIKGLLDVTCKTVANMI
KGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK
Download sequence
Identical sequences W5NRJ6
ENSOARP00000000786

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]