SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000000824 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000000824
Domain Number 1 Region: 88-398
Classification Level Classification E-value
Superfamily RNI-like 0.0000000000392
Family 28-residue LRR 0.065
Further Details:      
 
Domain Number 2 Region: 9-68
Classification Level Classification E-value
Superfamily F-box domain 0.000000000235
Family F-box domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000000824   Gene: ENSOARG00000000799   Transcript: ENSOART00000000857
Sequence length 443
Comment pep:known_by_projection chromosome:Oar_v3.1:11:24751365:24759131:-1 gene:ENSOARG00000000799 transcript:ENSOART00000000857 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEEDQLIQPQDQSCWATLPDVCLRRVFWWLGDRDRSRAALVCRKWNQTMYSADLWRYRT
ITFSGRPSRVHASEFESALWYVKKFGRYLEHLEIKFLNPYNAVLTKKFQVTMRGLLSCLG
KSNNRLKSFSIQHLELDRLVWRNSIRSSFMKSLSFFLKKMGKHLNYLSLKGARLTTEQGC
HILNALSYLRNGSTVTELNIEDYFSHHLAVYSSPQFNKTMATFRSLVSLTLNYNCISDEL
LENLCDNNPGTLRTMNIKCHIHDPHGQVIWGMSWARLARHATSLKVNFFFERVMKYEHLA
RILLQEIPIRSISLRSCYFSDPDWSMRPTLTDLLPTFRHTLQKLTFEFNNNHESLDEELH
LLILSCRKLFYFKIWAFLDVKFVERILKSREEGQCALRTLKVRIYTNRYETNEEDRTLRE
IYRKYRKLIDSELNYFVIAYPMM
Download sequence
Identical sequences W5NRN4
XP_012002315.1.54773 XP_012002316.1.54773 XP_012040923.1.66739 XP_012040924.1.66739 ENSOARP00000000824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]