SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000000840 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000000840
Domain Number 1 Region: 420-535
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000925
Family Pleckstrin-homology domain (PH domain) 0.051
Further Details:      
 
Weak hits

Sequence:  ENSOARP00000000840
Domain Number - Region: 768-868
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 0.00212
Family beta-lactamase inhibitor protein-II, BLIP-II 0.081
Further Details:      
 
Domain Number - Region: 111-205
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 0.0732
Family Regulator of chromosome condensation RCC1 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000000840   Gene: ENSOARG00000000813   Transcript: ENSOART00000000873
Sequence length 986
Comment pep:novel chromosome:Oar_v3.1:24:37641864:37672097:1 gene:ENSOARG00000000813 transcript:ENSOART00000000873 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLPSDRWPWSDVSGLQHRPLDGVALPSPHWSWESDWYVDENFGGEPTEKGGWTYAIDFP
AAYTRDKKWNSCVRRRRWIRYRRYKSQDTWAKVWYRENVSHHNPEGSSWSLVDTPGEAVQ
ISCGPHDLLWVTLWEGQALVREGINRNNPKGSSWSTVEPPTSENGILHVSTGVCVVWAVT
KDRKVWFRRGVNSHNPCGTSWIEMFGEMMMVNVGLNDQVWGISCVDRALYFRQGVTQSEL
SGKTWKVIVASREGDRSLSGSSSGLLSAGCFFGNEVRGSAESCGPGDTDTSWEVPGPASS
PAGVHGKESKKGPSHATANFPEATDLSSLTLLPLGLEEPDSADCHALWAWVSGGGCAVEA
HTTLKWFTAQSGPGPSVQTLSLCITPAQTAAWRKQISQQLTERAKRELESFQHYEQAVQQ
SVWVKTGALQWWCDWKPHKWMDVHVALEQLTGHDGAQDSILFIYYVVHEEKKYIHVFLNE
VTALVPVFSEAKHSFALYTPERTRQRWPVRLAAATEQDMSDWLALLNLSCCESRRVHGRP
SPQAIWSVTCKGDIFVSEPGPDLEGPERRLPCDQMWPGLCKDPKGASGTWRGWGXGYDHT
AWVYTGGYGGGCFQGLASSTSNVFTQRDVKCVHIYENQRWNPVTGYTSRGLPTDRYMWSD
ATGLQECTKASMKPPSLQWTWVSDWFVDFSVPGGTDPEGWQYASDFPASYHKYKTMKDFV
RRRCWARKCKLVTSGPWLEVTSVALRDVSIIPESPGAHGSGLNIALWAISDKGDVLCRLG
VSELNPEGFCWMHVGTDQPFTSVSIGACYQVWAVAKDGSAFYRSSVSPSRPNGDCWYHIP
PPPKQRLKQVSVGHTSVFALDENGNLWYRQGVTPSHPQGDSWEHVSSLWGPWTSRSLFQV
WVIADKVQGSHSLSRGTVCRRTGVQSLEPKGQGWDYGIGGGWDHLSIRASTTRAPESSSQ
KPASKQNGQPPSVAYGPWETPGPVCC
Download sequence
Identical sequences W5NRQ0
ENSOARP00000000840

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]