SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000000854 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000000854
Domain Number 1 Region: 41-226,350-467
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.09e-49
Family FAD-linked reductases, N-terminal domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000000854   Gene: ENSOARG00000000826   Transcript: ENSOART00000000887
Sequence length 473
Comment pep:known_by_projection chromosome:Oar_v3.1:7:82255656:82269182:1 gene:ENSOARG00000000826 transcript:ENSOART00000000887 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AGQRHGAQLARVRWGDVFAAAQKGPRVSCRRWAGASADNVYDVVVSGGGLVGAAMACALG
HDIHFCDKKILLLEAGPKKVLEKLPETYSNRVSSISPGSATLLSSFGAWDHICNMRYRAF
RRMQVWDACSEALIMFDKDNLDDMGYIVENDVIMHALTKQLEAVSDRVTVLYKSKAISYT
WPYPFSMADSSPWVHITLGDGRTLQTKLLIGADGHNSGVRQAAGIRNVSWNYDQSAVVAT
LHLSEATENNVAWQRFLPSGPIALLPLSDTLSSLVWSTSHEHAAELVSMEEEEFVDAINS
AFWSDVNHTDFIDSAGSMLQSAVAFLKPTRVSARQLPPSVARVDAKSRVLFPLGLGHAAE
YVRPRLALIGDAAHRVHPLAGQGVNMGFGDISSLLHHLSTAAFNGKDLGSMSHLTSYETD
RQRHNTALLAATDLLKRLYSTRATLLVLLRTWGLQATNAVPPLKEQIMAFASK
Download sequence
Identical sequences W5NRR4
ENSOARP00000000854

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]