SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000000901 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000000901
Domain Number 1 Region: 105-287
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.19e-76
Family F-box associated region, FBA 0.0000016
Further Details:      
 
Domain Number 2 Region: 43-125
Classification Level Classification E-value
Superfamily F-box domain 7.06e-17
Family F-box domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000000901   Gene: ENSOARG00000000874   Transcript: ENSOART00000000934
Sequence length 302
Comment pep:known_by_projection chromosome:Oar_v3.1:12:40138218:40142857:-1 gene:ENSOARG00000000874 transcript:ENSOART00000000934 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFPGLGPWGSVASTFLVQAHDDCCSPQACVCTSPPAAMALVSINQLPENILLEVFTHVPA
RQLLRNCRPVCCLWRDLIDLVSLWKRKCLREGYVTEDQDQPVSDWKVFYFLCSLRRNLLR
NPCAEEDMRFWKIDSNGGDQWKVESLPGAHGTGFPDAEVKKYFVTSYDMCLKSQIIDLRA
EGYWEELLDKFRPDIVVKDWFAPRADCGCTYHIRVQLASADYLVLASFEPPPVTIHQWND
AKWTEVSHTFSDYPPGVRHIFFQHGGKDTQFWAGWYGPRVTNSSVVISHRVTRNPPHTVA
QP
Download sequence
Identical sequences W5NRW1
ENSOARP00000000901

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]