SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000000959 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000000959
Domain Number 1 Region: 344-399
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000654
Family TSP-1 type 1 repeat 0.00061
Further Details:      
 
Domain Number 2 Region: 293-339
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000131
Family TSP-1 type 1 repeat 0.001
Further Details:      
 
Domain Number 3 Region: 458-505
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000196
Family TSP-1 type 1 repeat 0.00092
Further Details:      
 
Domain Number 4 Region: 399-454
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000458
Family TSP-1 type 1 repeat 0.00068
Further Details:      
 
Domain Number 5 Region: 929-1086,1123-1193
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000101
Family Rhodopsin-like 0.024
Further Details:      
 
Weak hits

Sequence:  ENSOARP00000000959
Domain Number - Region: 516-559
Classification Level Classification E-value
Superfamily Hormone receptor domain 0.00392
Family Hormone receptor domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000000959   Gene: ENSOARG00000000915   Transcript: ENSOART00000000992
Sequence length 1558
Comment pep:known_by_projection chromosome:Oar_v3.1:2:234812335:234842088:1 gene:ENSOARG00000000915 transcript:ENSOART00000000992 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LEDNPWRGKGHRMTPACPLLLSVILSLRLAAAFDPAPSACSALASGVLYGAFSLQDLFPT
IASGCSWTLENPDPTKYSLYLRFNRQEQVCTHFAPRLLPLDHYLVNFTCLRPSPEEEEKE
EEEAAGLELCGGSGPFTFLHFDKNFVQLCLSAEPSEAPRLLAPAALAFRFVEVLLINNNN
SSQFTCGVLCRWSEECSRAAGRACGFAQPGCSCPGEAGAGPAATTPALALSNALVPGGPA
PPAEADLHSGSSNDLFTTEMRYGEEPEEEPKVKTQWPRSADEPGLYMAQTGDPAAEEWSP
WSVCSLTCGQGLQVRTRSCVSSPYGTLCSGPLRETRPCNNSATCPVHGVWEEWGSWSLCS
RSCGRGSRSRMRTCVPPQHGGKACEGPELQTKLCSMAACPVEGQWLEWGPWGPCSTSCAN
GTQQRSRKCSVAGPAWATCAGALTDTRECGNLECPATDGKWGPWNAWSLCSKTCDTGWQR
RFRMCQATGAQGYPCEGTGEEVKPCSEKRCPAFHEMCRDEYVMLMTWKKAAAGEIIYNKC
PPNASGSASRRCLLSAQGVAYWGLPSFARCISHEYRYLYLSLREHLAKGQRMLAGEGMSQ
VVRSLQELLARRSYYSGDLLFSVDILRNVTDTFKRATYVPSADDVQRFFQVVSFMIDAEN
KDKWDDAQQVSPGSVHLLRVVEDFIHLVGDALKAFQSSLIVTDNLVISIQREPVSAVSSD
ITFPMRGRRGMKDWVRYSEDRLFLPKEVLSLSSPGKPATSGAAGNLGRGRGPGTVAPGPG
HSHQRLLPADPEDSSSYFVIGAVLYRTLGLILPPPRPPLAVTSRVMTVTVRPPTQPLAEP
LITVELSYIINGTTDPHCASWDYSRADASSGDWDTESCQTLETQAPPPRCRCQRLSTFAV
LAQPPKDLVSWEGSAQAGQEKRLLGARGHVWRYICGRAQHTPLNFCLSILASNILILVGQ
SRVLSKGVCTMTAAFLHFFFLSSFCWVLTEAWQSYLAVIGRMRTRLVRKRFLCLGWGLPA
LVVAVSVGFTRTKGYGTSSYCWLSLEGGLLYAFVGPAAVIVLVNMLIGIIVFNKLMARDG
ISDKSKKQRAGPERCPWASLLLPCSACGAVPSPLLSSASARNAMASLWSSCVVLPLLALT
WMSAVLAMTDRRSVLFQALFAVFNSAQGFVITAVHCFLRREVQDVVKCQMGVCRADESED
SPDSCKNGQLQILSDFEKDVDLACQTVLFKEVNTCNPSTITGTLSRLSLDEDEEPKSCLV
GPEGSLSFSPLPGNILVPMAASPGLGEPPPPQEANPVYMCGEGGLRQLDLTWLRPAEPGS
EGDYMVLPRRTLSLQPGGGAGGGEDPPRARPEGTPRRASKSLGHAEAYPSFLSVEHSGLG
LGPAYGSLQNPYGMTFQPPPPTPSARQVPEPGERSRTMPRTVPGSTMKLGSLERKKLRYS
DLDFEKVMHTRKRHSELYHELNQKFHTFDRYRSQSTAKVSAKWSVSSISTPDWVGPQEKP
SPGERPGVSQQRRHQSWSTFKSMTLGSLPPKPRERLALHRAAAWEPTEPPDGDFQTEV
Download sequence
Identical sequences W5NS19
ENSOARP00000000959

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]