SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000000966 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000000966
Domain Number 1 Region: 618-826
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.54e-49
Family DBL homology domain (DH-domain) 0.00047
Further Details:      
 
Domain Number 2 Region: 80-160
Classification Level Classification E-value
Superfamily F-box domain 6.93e-18
Family F-box domain 0.001
Further Details:      
 
Domain Number 3 Region: 848-957
Classification Level Classification E-value
Superfamily PH domain-like 8.33e-16
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000000966   Gene: ENSOARG00000000928   Transcript: ENSOART00000000999
Sequence length 959
Comment pep:known_by_projection chromosome:Oar_v3.1:8:63609664:63674228:1 gene:ENSOARG00000000928 transcript:ENSOART00000000999 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAGNSPRESLEMESFHTRFSAWTPFSNKSLNRQLFQERVALISHWFDLWTNKQRQEFLF
TIFLRCTKSQLRLIQDWFSERMQVAKVDFSTVLPRFISLYIFSFLNPKDLCAAAQVSWPW
KFLTEQDCLWMPKCIKFGWFLPYTPTDNEYGAWKHHYIACVSNLDWLTPREAAAVYGTLN
EPKTENEELQERQRERCLRKIIWEKIALHKKELFKVRPPWVSGTHCSRLFKSKCQPRLSQ
TARDRVGLHETLEKQLVLSSLESLPKRSNISGCHSYPLLSKKNWRGVYKNDSSSSNALQP
HFILISSRIPAYEMVANSVRAGIISVVYEHSGLTLETLLYLIEKALDGQMAQSVGIFSDG
DSREINLLQGYKIGIKNLLRPEVRDFWEKLGSYVAPEEEGGHVDLFVPLGASEAGIEVLS
QLSQLTGTLFTAPTGIATGSYQHLLSDWLGRQWETSPPSIYFSESKLQTWSSFTDFLEDT
LKSVRKQLSPLFKELQKNVSGRMIGQFVFDTMSVANILNNQEIIQALADGLIELSKENSD
NPLEFLSYFLLKKCSKKNKHFEGNVILTKSDPKTTHSLLTKERDVIEDNPQDTKPSLSKN
DPNFELLVKLERKLQLDSAEKRTRVIRELLQSERRYVQMLEIVRDVYVRPLRAALSSNRA
ILSAANIQIMFSDILQILCLNRRFLDDLRDRVQEWGPAHGVGEIFIKFGSQLNTYTNFFN
NYPVVLKTIEKCREMIPAFRAFLKRHDKTIVTNMLSLPELLLYPSRRFEEYIHLLYALRL
HTPAEHIDRGNLTIAIDQIKNYKGYIDQMKRNISMKDHLLDIQRLIWGCPTLSEANRYLI
RVQDVAQLHCCDEDISFYLRLYEHTCDLSLFLFNDALLVSSRGTSHTPFERTSKSTYQFI
ASVALHRLIIEDIPDSKFIKNAFILQGPKHEWICATEVEDDKFLWLSILQNAIKSSMEK
Download sequence
Identical sequences W5NS26
ENSOARP00000000966

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]