SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000000971 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000000971
Domain Number 1 Region: 564-772
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.02e-49
Family DBL homology domain (DH-domain) 0.00047
Further Details:      
 
Domain Number 2 Region: 68-148
Classification Level Classification E-value
Superfamily F-box domain 6.54e-18
Family F-box domain 0.001
Further Details:      
 
Domain Number 3 Region: 794-903
Classification Level Classification E-value
Superfamily PH domain-like 7.84e-16
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000000971   Gene: ENSOARG00000000928   Transcript: ENSOART00000001004
Sequence length 905
Comment pep:known_by_projection chromosome:Oar_v3.1:8:63609664:63674228:1 gene:ENSOARG00000000928 transcript:ENSOART00000001004 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESFHTRFSAWTPFSNKSLNRQLFQERVALISHWFDLWTNKQRQEFLFTIFLRCTKSQLR
LIQDWFSERMQVAKVDFSTVLPRFISLYIFSFLNPKDLCAAAQVSWPWKFLTEQDCLWMP
KCIKFGWFLPYTPTDNEYGAWKHHYIACVSNLDWLTPREAAAVYGTLNEPKTENEELQER
QRERCLRKIIWEKIALHKKELFKVRPPWVSGTHCSRLFKSKCQPRLSQTARDRVGLHETL
EKQLVLSSLESLPKRSNISGCHSYPLLSKKNWRGVYKNDSSSSNALQPHFILISSRIPAY
EMVANSVRAGIISVVYEHSGLTLETLLYLIEKALDGQMAQSVGIFSDGDSREINLLQGYK
IGIKNLLRPEVRDFWEKLGSYVAPEEEGGHVDLFVPLGASEAGIEVLSQLSQLTGTLFTA
PTGIATGSYQHLLSDWLGRQWETSPPSIYFSESKLQTWSSFTDFLEDTLKSVRKQLSPLF
KELQKNVSGRMIGQFVFDTMSVANILNNQEIIQALADGLIELSKENSERDVIEDNPQDTK
PSLSKNDPNFELLVKLERKLQLDSAEKRTRVIRELLQSERRYVQMLEIVRDVYVRPLRAA
LSSNRAILSAANIQIMFSDILQILCLNRRFLDDLRDRVQEWGPAHGVGEIFIKFGSQLNT
YTNFFNNYPVVLKTIEKCREMIPAFRAFLKRHDKTIVTNMLSLPELLLYPSRRFEEYIHL
LYALRLHTPAEHIDRGNLTIAIDQIKNYKGYIDQMKRNISMKDHLLDIQRLIWGCPTLSE
ANRYLIRVQDVAQLHCCDEDISFYLRLYEHTCDLSLFLFNDALLVSSRGTSHTPFERTSK
STYQFIASVALHRLIIEDIPDSKFIKNAFILQGPKHEWICATEVEDDKFLWLSILQNAIK
SSMEK
Download sequence
Identical sequences W5NS31
ENSOARP00000000971

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]