SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000000988 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000000988
Domain Number 1 Region: 142-203
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 9.31e-21
Family Complement control module/SCR domain 0.0039
Further Details:      
 
Domain Number 2 Region: 83-141
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000012
Family Complement control module/SCR domain 0.00085
Further Details:      
 
Domain Number 3 Region: 27-78
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000135
Family Complement control module/SCR domain 0.0029
Further Details:      
 
Weak hits

Sequence:  ENSOARP00000000988
Domain Number - Region: 2-22
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0459
Family Complement control module/SCR domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000000988   Gene: ENSOARG00000000956   Transcript: ENSOART00000001021
Sequence length 204
Comment pep:novel scaffold:Oar_v3.1:JH922771.1:2680:35444:1 gene:ENSOARG00000000956 transcript:ENSOART00000001021 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTCTESGWSPPPRCIRVKTCSKSEIRIENGFLSESAFMYPLNKQTEYKCKPGYVTADGKT
SGLITCLQDGWSAQPVCINSKGKCGPPPPIDNGDITSLLQSVYPPGYTAEYQCQLYYELR
GNRNIVCQNGEWSEPPKCLEACVISEETMKKHHIQLRWKHDTKLYYKTEDTIEFTCEYGY
HQLTPKHTFRTTCQEGKVVYPRCG
Download sequence
Identical sequences W5NS48
ENSOARP00000000988

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]