SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000001032 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000001032
Domain Number 1 Region: 2-102
Classification Level Classification E-value
Superfamily PH domain-like 1.72e-36
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.00000162
Further Details:      
 
Domain Number 2 Region: 168-264
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 9.42e-35
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000627
Further Details:      
 
Domain Number 3 Region: 343-454
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 1.16e-24
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000001032   Gene: ENSOARG00000000995   Transcript: ENSOART00000001066
Sequence length 466
Comment pep:known_by_projection chromosome:Oar_v3.1:4:87993675:88031409:-1 gene:ENSOARG00000000995 transcript:ENSOART00000001066 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TMSSAVVQLYAADRNCMWSKKCSGVACLVKDNPQRSYFLRIFDIKDGKLLWEQELYNNFV
YNSPRGYFHTFAGDTCQVALNFANEEEAKKFRKAVTDLLGRRQRKSEKRRDPPNGPNLPM
ATVDIKNPEITTNRFYGPQINNISHTKEKKKGKAKKKRLTKADIGTPSNFQHIGHVGWDP
NTGFDLNNLDPELKNLFDMCGISEAQLKDRETSKVIYDFIEKTGGVEAVKNELRRQAPPP
PPPSRGGPPPPPPPPHSSGPPPPPARGRGAPPPPPSRAPTAAPPPPPPSRPGVGVPPPPP
NRMYPPPLPALPSSAPSGPPPPPPPLSVSGSVAPPPPPPPPPPPGPPPPPGLTSDGDHQV
PTPAGSKAALLDQIREGAQLKKVEQNSRPVSCSGRDALLDQIRQGIQLKSVTDAPESTPP
APAPTSGIVGALMEVMQKRSKAIHSSDEDEDEDDDEDFEDDDEWED
Download sequence
Identical sequences W5NS92
ENSOARP00000001032

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]