SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000001132 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000001132
Domain Number 1 Region: 68-251
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.23e-75
Family F-box associated region, FBA 0.00000187
Further Details:      
 
Domain Number 2 Region: 4-83
Classification Level Classification E-value
Superfamily F-box domain 1.27e-16
Family F-box domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000001132   Gene: ENSOARG00000001090   Transcript: ENSOART00000001167
Sequence length 255
Comment pep:known_by_projection chromosome:Oar_v3.1:12:40162724:40166795:-1 gene:ENSOARG00000001090 transcript:ENSOART00000001167 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVGNINELPENILLELFTHVPARQLLLRCRLVCSLWRDLIDLVTLWKRKCLREGFITED
WDQPVADWKVFYFLRSLHRNLLHNPCAEEGFEFWSLDVNGGDEWKVEDLSKDQRKEFPND
QVKKYFVTSYYTCLKSQVVDLKAEGYWEELMDTTRPDIEVKDWFAARPDCGSKYQLCVQL
LSSAHAPLGTFQPDPAMIQQKSDAKWREVSHTFSNYPPGVRYIWFQHGGVDTHYWAGWYG
PRVTNSSITIGPPLP
Download sequence
Identical sequences W5NSJ2
XP_004013770.1.66739 XP_011966699.1.54773 XP_011966700.1.54773 XP_011966701.1.54773 XP_012042718.1.66739 ENSOARP00000001132

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]