SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000001236 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000001236
Domain Number 1 Region: 113-299
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.76e-75
Family F-box associated region, FBA 0.0000000184
Further Details:      
 
Domain Number 2 Region: 50-143
Classification Level Classification E-value
Superfamily F-box domain 0.000000000000327
Family F-box domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000001236   Gene: ENSOARG00000001194   Transcript: ENSOART00000001275
Sequence length 299
Comment pep:known_by_projection chromosome:Oar_v3.1:12:40167280:40172744:1 gene:ENSOARG00000001194 transcript:ENSOART00000001275 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGDGDPDSIGGPAIPRTQGPNPSSDGPAEASQDPKDRKRSEETLLPKYVLHLPEPLLLR
VLAELPAAQLVQACRLVCLRWKELVDGAPLWLLKCQQEGLVPQEGPEDERDHWQQFYFLS
KRRRNLLRNPCGEEDLEGWCDVEHGGDGWRVEELPGDCGMEFTHDESVKKYFASSFEWCR
KAQIIDLQAEGYWEELLDTTQPAIVVKDWYSGRRDAGCLYELTVKLLSEHEDVLAEFNSG
QVAVPADSDGGGWIEISHTFTDYGPGVRFVRFEHGGQDCVYWKGWFGARVTNSSVWVEP
Download sequence
Identical sequences W5NSU6
ENSOARP00000001236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]