SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000001465 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000001465
Domain Number 1 Region: 40-147
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-31
Family Spermadhesin, CUB domain 0.00037
Further Details:      
 
Domain Number 2 Region: 861-1140
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000000000000043
Family Rhodopsin-like 0.02
Further Details:      
 
Domain Number 3 Region: 167-344
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000000369
Family Pentraxin (pentaxin) 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000001465   Gene: ENSOARG00000001397   Transcript: ENSOART00000001505
Sequence length 1250
Comment pep:known_by_projection chromosome:Oar_v3.1:8:66712507:66862248:1 gene:ENSOARG00000001397 transcript:ENSOART00000001505 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMFHSDRMWSCHWKWKPSSLLFLFALCLVYAPLSVWACANCRVVLSNPSGTFTSPCYPND
YPNSQACMWTLRAPTGYIIQITFNDFDIEEAPNCIYDSLSLDNGESQTKFCGATAKGLSF
NSSANEMHVSFSSDFSIQKKGFNASYIRVAVSLRNQKVILPQSLDSYQVSVAKSVSIPEL
RAFTLCFEATKIGKEDSEWIAFSYSGASFPQLLSFGKTKSGYFLSFFGSKCLLNSALPVK
DKEDIFTESFEQLCIVWSSSLGSIGVNFKRNYGTVSCNSTISKVIPGNGKLLLGSNQHDI
GSLKGDIYNFRLWNFTMSSKILSNLSCSVKGNVVDWQNDFWNIPTLALKAESNLSCGSYL
IPLPAAELASCADLGTLCQATVNPPSTTSPTVTTNMPVTNRTDKQRNDGTIYRISIVIQN
ILPHPEVKVQSKVAEWLNSTFQNWNYTVYVVNISFHLSTGEDKIKVRRSVVTDQRLVILA
LLVYNATNNPTLEGRTIQQKLLRNNESLDEGLRLHTVNVRQLGICHSDEKPKGYKWPSIQ
PSEYRMPCPGKQGFSASRTCYKDSVNTSVAYWGHPDISNCSREANEVASQILNLTSDGQT
LSSANITSIVEQVKRIVNKEENIDITLGSTLMNIFSNILTSPDSDLLESSSEALKTIDEL
AFKIDLQSTTHVNITTRNLALGVSSVSPETNEISNFSIGLPSNNESYFQMDFKSGQMDPL
ASVILPPNLLENLSEEDSVLVKRAQFTFFNKTGLFQDVGTKKVTLVSYVMACSIGNITIQ
DLKDPVQIKIKHTRTQAVAHPICAFWDLNKNEGSGFWNTSGCDAHKDSDANETICLCNHL
THFGVLMDLQGTASQLDAKNTKILTFITYIGCGISAIFSAATLLTYVAFEKLRRDYPSKI
LMNLSTALLFLNLVFLLDGWITSFHVDGLCTAIAALLHFFLLATFTWMGLEAIHMYIALV
KVFNTYIRRYILKFCIVGWGVPVLVVSIVLASRKQNEVYGKDSYGKEQGDEFCWIQDPVV
FYVTCAGYFGLMFFLNVAMFIVVMVQICGRNGKRSSRTLREEVLRNLRSVVSLTFLLGMT
WGFAFFAWGPLNVPFMYLFSIFNSLQGLFIFIFHCAMKENVQKQWRRHLCCGRFRLADNS
DWSKTATNIIKKSSDNLGKSLSSSSIGSNSTYLTSKSKSSSTTYFKRNSHTDNASMDKSS
SKLTHADGEQTSIIPVHQVIDKVKGYCNAHSDNFYKNIIMSDTFSHSTKF
Download sequence
Identical sequences W5NTH3
ENSOARP00000001465 XP_004011434.2.66739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]