SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000001522 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000001522
Domain Number 1 Region: 421-784
Classification Level Classification E-value
Superfamily SIS domain 2.41e-105
Family double-SIS domain 0.000000425
Further Details:      
 
Domain Number 2 Region: 104-311,352-396
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 9.26e-55
Family Class II glutamine amidotransferases 0.0000117
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000001522   Gene: ENSOARG00000001456   Transcript: ENSOART00000001565
Sequence length 784
Comment pep:known_by_projection chromosome:Oar_v3.1:5:585027:629216:1 gene:ENSOARG00000001456 transcript:ENSOART00000001565 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLDLNSGSSPRPPTCVPARTCYSREAAPRLRRADSRGPGARRCHDNRRPMGSGQAERGP
APPPPLAPGSGYKGRRPGRAPECRRLAASGGRDPGGARGAAEMCGIFAYMNYRVPRTRKE
IFETLIKGLQRLEYRGYDSAGVAIDGNNNEVKERHIQLVKKRGNVKALDEELYKQDSMDL
KVEFETHFGIAHTRWATHGVPNAVNSHPQRSDKGNEFVVIHNGIITNYKDLRKFLESKGY
EFESETDTETIAKLIKYVFDNRETEDITFSTLVERVIQQLEGAFALVFKSIHYPGEAVAT
RRGSPLLIGVRSKYKLSTEQIPVLYRTRNIENVKNICKTRMKRLDSSTCLHAVGDKAVEF
FFASDASAIIEHTNRVIFLEDDDIAAVADGKLSIHRVKRLASDDPSRAIQTLQMELQQIM
KGNFSAFMQKEIFEQPESVFNTMRGRVNFETNTVLLGGLKDHLKEIRRCRRLIVIGCGTS
YHAAVATRQVLEELTELPVMVELASDFLDRNTPVFRDDVCFFISQSGETADTLLALRYCK
DRRALTVGVTNTVGSSISRETDCGVHINAGPEIGVASTKAYTSQFISLVMFGLMMSEDRI
SLQNRRREIIHGLKSLPELIKEVLSLDEKIHDLALELYTQRSLLVMGRGYNYATCLEGAL
KIKEITYMHSEGILAGELKHGPLALIDKQMPVIMVIMKDPCFAKCQNALQQVTARQGRPI
ILCSKDDTESSKFAYKTIELPHTVDCLQGILSVIPLQLLSFHLAVLRGYDVDFPRNLAKS
VTVE
Download sequence
Identical sequences W5NTN0
ENSOARP00000001522

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]