SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000001524 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000001524
Domain Number 1 Region: 14-299
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 1.48e-73
Family Regulator of chromosome condensation RCC1 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000001524   Gene: ENSOARG00000001462   Transcript: ENSOART00000001567
Sequence length 338
Comment pep:novel chromosome:Oar_v3.1:15:34048942:34106341:1 gene:ENSOARG00000001462 transcript:ENSOART00000001567 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XPEPHSLEAVPTAAALFAWGANSYGQLGLGHKEDVLSAQQLSDFCKSGCIKQITGGGGHS
AVVTDEGSLFVCGLNKDGQLGLGHTEEVLYFTPCKSLLGCAIQQVACGWDFTIILTENGQ
VLSCGSNSFGQLGVPRGPRRCVIPQAIELLREKVVSIAAGLRHALAATASGTVFQWGTGL
ASSGRRLCPGQTLPLFLTAKEPSTVTVGLENSQAVCVLAGSDHSASLTDAGELYVWGSNK
HGQLASQAAFLLLPQRIEAHCFQNEKIAAVWSGWTHLVAQTVTGKVFTWGRADYGQLGRT
VETREGWQSEKQDPSLPGSGPQKGTPSCLPCLTGATEV
Download sequence
Identical sequences W5NTN2
ENSOARP00000001524

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]