SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000001582 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000001582
Domain Number 1 Region: 481-572
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000011
Family Anti-sigma factor antagonist SpoIIaa 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000001582   Gene: ENSOARG00000001513   Transcript: ENSOART00000001625
Sequence length 609
Comment pep:known_by_projection chromosome:Oar_v3.1:11:51403870:51420152:-1 gene:ENSOARG00000001513 transcript:ENSOART00000001625 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CPTSAPDMSPPMSPMKPPKGFAPMSCCWSTETMQKWLPFLGWLPDYTWYALKMDFIAGIS
VGLTVIPQALAYAEVAGLPPQYGLYSAFMGCFVYFFLGTSRDVTLGPTAIMSLLVSFYTF
HEPAYAVLLAFLSGCIQLGMGFLRLGLLLDFISCPVIKGFTSAAAIIIGFGQIKNLLGLQ
HIPRQFFLQVYYTFHNIGETRVGDAVLGLVCMVLLLVLKLMRDHVPPVHPEMPTGVRLSH
GLVWTATTARNALVVSFAALVAYSFQVTGYQPFVLTGKTPEGLPDAHIPPFSVTTANGTI
SFTEMVQGMGAGLVVVPLMGLLESIAVAKSFASQNNYRINSNQELLAIGLTNILGSLFSS
YPVTGSFGRTAVNAQSGVCTPAGGLMTGALVLLSLDYLTSLFYYIPKSALAAVIIMAVVP
LFDTKIVRTLWRVKRLDLLPLCVTFLLCFWEVQYGILAGALVSVLILLHSVARPKIQVSE
GPMLVLQPASGLHFPAIETLREALLSRALETSPPRSVALDCTHICSIDYTVVLGLGELLE
DFHKRGATLALIGLQVPVLRVLLSADLKGVLYFCTLEEAEKYLKQEPGTQPYNGSEDSVP
EHKIALLKA
Download sequence
Identical sequences W5NTT8
ENSOARP00000001582

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]