SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000001648 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000001648
Domain Number 1 Region: 627-681
Classification Level Classification E-value
Superfamily RING/U-box 0.00000795
Family RING finger domain, C3HC4 0.065
Further Details:      
 
Weak hits

Sequence:  ENSOARP00000001648
Domain Number - Region: 506-538
Classification Level Classification E-value
Superfamily F-box domain 0.000628
Family F-box domain 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000001648   Gene: ENSOARG00000001577   Transcript: ENSOART00000001691
Sequence length 707
Comment pep:known_by_projection chromosome:Oar_v3.1:9:76838577:76849876:1 gene:ENSOARG00000001577 transcript:ENSOART00000001691 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RPFKAQSEKFPLSEAYLRLNSSSKKFVETEILKMSERHSGEAGTGAGNEVDSPIVRLKSS
SFGDLCSTSSFQDSGYSELLKSCSFDNTDKELFGKKERGSTLIHEYPETSSLALTHSLES
PTQRKRFVFLRKENDKTPDLCETPKVSGKKHLLRRRLDISFSLLDRDVESQSSSLESSTS
QVPNLEKNIPSSASGFPRQDTFSSSVTSTLRTEEVTSSSQKLRLNFSQQKTSTVDDSKDD
CGLFEVECISPIQGSNFKDSITHDFSDSSLCINNENTYPELLGSSVGGTSCRTDEDIFVT
PISNLLPSVKFNASRRFSPSAGVRRNISTPEDSGFNSLCLDKSEDPLSEQEGSFQELLQK
HKGTLKVGDTIKKSRRLGRLRRLSTLREQGSQSETEEENQTYLSSSESTPATASDISESQ
PSSDNKSEDLSFKNLSKTPALQLVHELFMKSKRKRFQQNGAHELLEERDGGKIAVLQRVL
AGLIGKKMGIEKLDILTELKYRNLKHVLAMVLDSLTAESLCSVWKVSRNWREIIVQDKKA
NRRRKLHITQLKTNSEGAVLNVEDAATRLHLLNRSALRSVQAQARTPGFQKEQASTFSPW
GEVLTPIASSSVTHLSSSKQEEYVKVAKTLFIDEALKPCPRCQSPAKYQPYKKRGLCSRT
ACGFDFCVLCLCAYHGSEECSRGAAKPRNRKDVLPGSAQSKRNLKRL
Download sequence
Identical sequences W5NU04
ENSOARP00000001648

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]