SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000001766 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000001766
Domain Number 1 Region: 37-154
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 9.16e-39
Family Frizzled cysteine-rich domain 0.0000594
Further Details:      
 
Domain Number 2 Region: 170-280
Classification Level Classification E-value
Superfamily TIMP-like 0.0000000000000111
Family Tissue inhibitor of metalloproteinases, TIMP 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000001766   Gene: ENSOARG00000001680   Transcript: ENSOART00000001809
Sequence length 294
Comment pep:known chromosome:Oar_v3.1:17:3719522:3727430:1 gene:ENSOARG00000001680 transcript:ENSOART00000001809 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPQGPGSLLLIVLASHCCLGSARGLFFGQSDFPYKRSNCKPIPANLQLCHGIEYQNMRLP
NLLGHETMKEVLEQAGAWIPLVMKQCHPDTKKFLCSLFAPVCLDDLDETIQPCHSLCVQV
KDRCAPVMSAFGFPWPDMLDCDRFPQDNDLCIPLASSDHLLPATEEAPKVCEACKTKNED
DNDIMETLCKNDFALKIKVKEITYINRDTKIILETKSKTIYKLNGVSEKDLKKSVLWLKD
SLQCTCEEMNDINAPYLVMGQKLGGELVITSVKRWQKGQREFKRISRSIRKLQC
Download sequence
Identical sequences C5IWT3
ENSOARP00000001766 NP_001156525.1.54773 NP_001156525.1.66739 XP_005978295.1.78601 XP_013825951.1.57651

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]