SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000001844 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000001844
Domain Number 1 Region: 307-691
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 1.66e-81
Family Regulator of chromosome condensation RCC1 0.00023
Further Details:      
 
Domain Number 2 Region: 16-298
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.31e-79
Family Protein kinases, catalytic subunit 0.0000056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000001844   Gene: ENSOARG00000001738   Transcript: ENSOART00000001891
Sequence length 942
Comment pep:known_by_projection chromosome:Oar_v3.1:7:83238674:83275670:-1 gene:ENSOARG00000001738 transcript:ENSOART00000001891 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PVQRAGGGAAEQEELHYIPIRVLGRGAFGEATLYRRTEDDSLVVWKEVDLTRLSEKERRD
ALNEIVILALLQHDNIIAYYNHFMDNTTLLIELEYCNGGNLYDKILRQKDKLFEEEMVVW
YLFQIVSAVSCIHKAGILHRDIKTLNIFLTKANLIKLGDYGLAKKLNSEYSMAETLVGTP
YYMSPELCQGVKYNFKSDIWAVGCVIFELLTLKRTFDATNPLNLCVKIVQGIRAMEVDSS
QYSLELIQMVHACLDQDPEQRPTADELLDRPLLRKRRSREMEEKVTLLNAPTKRPRSSTV
TEAPIAVVTSRTSEVYVWGGGKSTPQKLDVIKSGCSARQVCAGNTHFAVVTVEKELYTWV
NMQGGTKLHGQLGHGDKASYRQPKHVEKLQGKAIRQVSCGDDFTVCVTDEGQLYAFGSDY
YGCMGVDKVAGAEVLEPMQLDFFLSNPVEQVSCGDNHVVVLTRNKEVYSWGCGEYGRLGL
DSEEDYYTPQKVDVPKALIIVAVQCGCDGTFLLTQSGKVLACGLNEFNKLGLNQCMSGII
NHEAYHEVPYTTSFTLAKQLSFYKIRTIAPGKTHTAAIDERGRLLTFGCNKCGQLGVGNY
KKRLGINLLGGPLGGKQVIRVSCGDEFTIAATDDNHIFAWGNGGNGRLAMTPTERPHGSD
ICTSWPRPIFGSLHHVPDLSCRGWHTILIVEKVLNSKTIRSNSSGLSIGTVVQSSSPGGG
SGGGREDDSQQESETPDPSGGFRGTMEADRGMEGLVSPTEAMRISSGASSSCPGWLRKEL
ENAEFIPMPDSPSPLSAAFSESERDTLPYDELQGLKMASEAPLEHKPPAGAWPPRLNPAG
TCAGKATPLVPPCACSTLQVEVERLQGLVLKCLAEQQKLQQENLQIFTQLQKLNKKLEGG
QQVGMHSKGTQTAKDETEMDPKPDLDSDSWCLLGTDSCRPSL
Download sequence
Identical sequences W5NUK0
ENSOARP00000001844

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]