SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000001911 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000001911
Domain Number 1 Region: 147-258
Classification Level Classification E-value
Superfamily Troponin coil-coiled subunits 6.28e-31
Family Troponin T 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000001911   Gene: ENSOARG00000001823   Transcript: ENSOART00000001958
Sequence length 262
Comment pep:known_by_projection chromosome:Oar_v3.1:14:59548305:59556856:1 gene:ENSOARG00000001823 transcript:ENSOART00000001958 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GEIDPDPPGAQESVGDKETEMGQAEKRSKSGGGTVLETKDLRSRPVVPPLIPPKIPEGER
VDFDDIHRKRMEKDLLELQTLIDVHFEQRKKEEEELVALKERIERRRAERAEQQRFRTEK
ERERQAKLAEEKMRKEEEEAKKRAEDDAKKKKVLSNMGAHFGGYLVKAEQKRGKRQTGRE
MKVRILSERKKPLNIDHMGEEQLREKAQELSDWIHQLESEKFDLMAKLKQQKYEINVLYN
RISHAQKFRKGAGKGRVGGRWK
Download sequence
Identical sequences W5NUR7
ENSOARP00000001911

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]