SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000002068 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000002068
Domain Number 1 Region: 31-99
Classification Level Classification E-value
Superfamily TRAF domain-like 0.0000000000497
Family SIAH, seven in absentia homolog 0.013
Further Details:      
 
Domain Number 2 Region: 608-655
Classification Level Classification E-value
Superfamily F-box domain 0.000000000222
Family F-box domain 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000002068   Gene: ENSOARG00000001970   Transcript: ENSOART00000002117
Sequence length 745
Comment pep:known_by_projection chromosome:Oar_v3.1:8:70024298:70031522:-1 gene:ENSOARG00000001970 transcript:ENSOART00000002117 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEELQHSHCVNCVSRRCMTRPEPGISCDLIGCPLVCGAVFHGCKADEHRLLCPFERVPC
LNSDFGCPFTMARNKVAEHLEMCPASVVCCTMEWNRWPVSYADRKSYENLSRDVDEVAQL
DMALALQDQRMLLESLKVATMMSKATDKVSEPREQISVKPSVSEIPHTNGLVSVDEESYG
ALYQATVETTRSLAAALDILNTATRDIGMLSTSLCASPNEMNEEQNARESLQNRNPKDQD
HLYEDEMGAVGGIDHKDASQSAQLEQNGSSDLLCDLDASSYGTPALCNGFPLEDICAQVI
EQNQDLRTDSKQSNLTNGECVASDGSSEPSSSLLVAAQIREVIPPDALPNGTVQHILMPD
DDEDLCWKKVDLGDLRNVDVLSFSHPPSFKFLSNSCWSKPKEDKAVDTSDLEVAEDPMGL
QGIDLITAALLFCLGDSPGGRGISDSRMADVYHVDFGTQTFSLPSAILATNTMVGEIASA
SACDHANPQLSNPSPFQTLGLDLVLECVARYQPKQRPMFTFVCGQLFRRKEFSSHFKNVH
GDIHAGLNGWMEQRCPLAYYGCTYSQRRFCPSTQGAKIIHDHHLRSFGVQPSVSTVLVEP
ARNCVLGLHSDHLSSLPFEVLQHIAGFLDGFSLCQLSCVSKLMRDVCGSLLQSRGMVILQ
WGKKKYPEGNSSWQIKEKVWRFSTAFCSVDEWKFADILSMADHLKKCSYNIVEKREEAIP
LPCMCVTRELTKEGRSLRSVLKPVL
Download sequence
Identical sequences W5NV72
XP_011976906.1.54773 XP_014952945.1.66739 ENSOARP00000002068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]