SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000002216 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000002216
Domain Number 1 Region: 181-376
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.1e-52
Family Reprolysin-like 0.00031
Further Details:      
 
Domain Number 2 Region: 395-473
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 1.18e-18
Family Blood coagulation inhibitor (disintegrin) 0.00026
Further Details:      
 
Weak hits

Sequence:  ENSOARP00000002216
Domain Number - Region: 616-650
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0737
Family EGF-type module 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000002216   Gene: ENSOARG00000002101   Transcript: ENSOART00000002267
Sequence length 741
Comment pep:known_by_projection chromosome:Oar_v3.1:26:33174931:33293614:-1 gene:ENSOARG00000002101 transcript:ENSOART00000002267 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLCLLSLLLGLTGLQTDDNSERLRVQFTVPEKIRSTSSGGVETHVSYNILIEGKTYTVNL
MQKAFLPHNFRVYGYSGTGSMKPLEQQFQNFCYYQGYIEGYPNSVAIISTCGGLRICRGL
LQFENVSYGIEPLEPSIGFEHMVYQVKPRDSSSSVYTEKEIEPREKPYKIQNVEPLPDFS
QYIEMHIVVEKDLYNHMGADTTIVIQKIFQLTGLTNAIFTSFNITVILSSLELWIDENKI
PVTGDANELLHRFLKWKRSYLVLRPHDVAFLLVYREKSNYIGATFQGRMCDKHYGGGVAL
HSNTISLESLAVIIAQLLSLSMGIPYDDINKCHCPGEVCIMNPAAVHSSGVKFFSTCSVE
DFLHFISKPKSQCLQNHPRLDPTYKAAVCGNGQVEEGEQCDCGGQQACDDKTNTCCNPGT
CRFLPGSVCDTGLCCDSCAFSPKGNICRGSVDECDLHEYCNGSSAECQEDVYIQDGHPCG
QNQWLCIRGKCMDGGKQCVELFGEGSSFAPLECFKKLNSMKDQSGNCGVTRTGFTPCRSE
NVKCGKIQCTYSKTRIIYVENASVLYSNINGQRCVGLDYAYGTEGSEMMWVKDGTVCGER
KVCRNKQCVDSSYLNYDCTPEKCNNQGVCNNKKNCHCNPSYLPPNCQHPLPSWEGGSIDS
GNFPPSSTGGAATLSGPDSRYIENVYRSKPTRWPFFLFIPFFIILCVLIATLVKVYFQRK
KWRTEDYTSDEQLESESEPKE
Download sequence
Identical sequences W5NVM0
ENSOARP00000002216

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]