SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000002240 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000002240
Domain Number 1 Region: 340-389
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000353
Family TSP-1 type 1 repeat 0.0011
Further Details:      
 
Domain Number 2 Region: 248-297
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000051
Family TSP-1 type 1 repeat 0.0012
Further Details:      
 
Weak hits

Sequence:  ENSOARP00000002240
Domain Number - Region: 963-1098
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00229
Family Rhodopsin-like 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000002240   Gene: ENSOARG00000002124   Transcript: ENSOART00000002291
Sequence length 1493
Comment pep:known_by_projection chromosome:Oar_v3.1:9:14648230:14719519:-1 gene:ENSOARG00000002124 transcript:ENSOART00000002291 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ARGQGPHWRLGARVGTALSVPSPGAQPCPLLFLFQLLLETMXFSAAAVFPANASRCSWTL
RNPDPRRYTLYMKVAKAPACSGPARVRTYQFDSFLESTRTYLGVESFDEVLRLCDPSAPL
AFLQASKQFLQMQRLRPPQDNTLGARDGPPGPSDDFSVEYLVVGNRNPSRAACQMLCRWL
DACLAGSRSSHPCGIMQTPCACLGGDTGDPASGSLAPRGDVCLRDGVAGGPENCLTSLTQ
DRGEDGAPGGWKLWSLWGECTRDCGGGLQTRTRTCLPAPGIEGGGCEGVLEEGRLCNRKA
CGPAGRTNSRSQSLRSTDARRREELGDDLQQFGFPAPQTGDPAAEEWSPWSVCSSTCGEG
WQTRTRFCVSSSYSTQCSGPLREQRLCNNSVVWKETPAGEVAAVRCPRNATGEGQGGRGW
QGTCPSLAGCAGGTKMPRRPAQELSAQGTWPRPRPGSPMRTKTRGVRAGTQGCHVLSHWS
ECQHEHANLWSDTSVLQIQESKVKTQVAGWCDFSSLCLLCPGSSLGSSRLCLAPWNQPQG
CPVSTAHQGHEGPPDPRGGAGQRHLGAVAGSGRWSQPPISTGLILRRCELDEEGIAYWEP
PTYIRCVSIDYRNIQMMTREHLAKAQRGLPGEGVSEVIQTLVEISQDGTSYSGDLLSTID
VLRNMTEIFRRAYYSPTPGDVQNFVQIISNLLAEENRDKWEEAQLMGPNAKELFRLVEDF
VDVIGFRMKDLRDAYQVTDNLALSIHKLPASGATDISFPMKGWRATGDWAKVPEDRVTVS
KSVFSTGLAEADDSSVFVVGTVLYRNLGSFLALQRSPSVITLQPVGQGCLPSPVCAPWWP
DFHHLFQGTTNQTCILWDETDPLAPPPPTPPPSPWFPWRGRDTVPTPCSLTRVICAHSGF
LLLRGRTPMSHSHSSLSVPALSLVRSCGYRDLLFQRRTLPWLSLWRAPKMYIRSERSVIL
INFCLSIISSNALILIGQTQTRNKAVCTLVAAFLHFFFLSSFCWVLTEAWQSYMAVTGRL
RNRLVRKRFLCLGWGLPALVVAISVGFTKARGYSTMNYCWLSLEGGLLYAFVGPAAAVVL
VNMVIGILVFNKLVSKDGITDKKLKERAGASLWSSCVVLPLLALTWMSAVLAVTDRRSAL
FQILFAVFDSLEGFVIVMVHCILRREVQDAVKCRVVDRQEEGNGDSGGSFQNGHAQLMVG
FGAGTQTAPARPQQPDRRTSEPSLRLGSRRGETRSPGAWPGSRDEGAGRGRCLPRAHPLV
PATPSVRTPSAPLPPLPVQTLVTSWVNSPRCHLVPAARWVPPAGRALAEASGRAQXPSLA
RSSPSACPHPQPSVPPPFSSHVPTSLKAAQQRGQCAVPPAGGLCATPPGSTGCPXGGSQP
QGAQAWKARRPASPLWEWAPLAGWEPEAWAGASLPPPGPPGVCQGPAWGGDLRVCSPVYT
NPFSPQRRKSRYAELDFEKIMHTRKRHQDMFQDLNRKLQHTEKDKDVLGPDSK
Download sequence
Identical sequences W5NVP4
ENSOARP00000002240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]