SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000002503 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000002503
Domain Number 1 Region: 2-111
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 1.83e-32
Family Frizzled cysteine-rich domain 0.00017
Further Details:      
 
Domain Number 2 Region: 123-250
Classification Level Classification E-value
Superfamily TIMP-like 3.92e-21
Family Netrin-like domain (NTR/C345C module) 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000002503   Gene: ENSOARG00000002359   Transcript: ENSOART00000002555
Sequence length 256
Comment pep:known_by_projection chromosome:Oar_v3.1:26:34708544:34747853:-1 gene:ENSOARG00000002359 transcript:ENSOART00000002555 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DLRLCHNVGYKRMVLPNLLEHETMAEVKQQASSWVPLLNKNCHIGTQVFLCSLFAPVCLD
RFDVAGPIFPCRWRCEAGRDWGEPVMQFFGFYWPEMLKCDKFPEGDVCIAMTPPNATEAS
PLPCTTVCPPCDNELKSEAIIEHLCASEFALRMKIKEVKKENGDKKIVPKKKKPLKLGPI
KKKELKKLVLYLKNGADCPCHQLDNLSHHFLIMGRKVKSQYLLTAIHKWDKKNKEFKNFM
KKMKNHECPTFQSVFK
Download sequence
Identical sequences W5NWF6
ENSOARP00000002503

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]