SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000002566 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000002566
Domain Number 1 Region: 110-168
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000126
Family TSP-1 type 1 repeat 0.0053
Further Details:      
 
Domain Number 2 Region: 50-107
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000131
Family TSP-1 type 1 repeat 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000002566   Gene: ENSOARG00000002422   Transcript: ENSOART00000002619
Sequence length 288
Comment pep:novel scaffold:Oar_v3.1:JH921818.1:21:11809:-1 gene:ENSOARG00000002422 transcript:ENSOART00000002619 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADSLCAAQRARRAANQKAARGGLWPGCPQPILPSPPAAICDIPFLSAETFWELGNWTHC
SATCGHLGAQVQRPQCLMANGQEVSEAFCDQLRKPRAAFQPCNIRDCPPRWLTGAWSECS
VSCGEGFRSRQVTCKRTRANGTVQALPPRVCILRDRPLGRRPCSSHPCVQGLFEQGNQCL
GRCLGRTVRTQQHHVICQHPNSSESGCDDTKRYWPHPGAAHNLPTSDKDCDVWKWHHPSR
APPLIMHSSYSIITSYGAILSGVCYAVAIPSLRRVRLFASPWTAACSL
Download sequence
Identical sequences W5NWL9
XP_011963291.1.66739 ENSOARP00000002566

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]