SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000002721 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000002721
Domain Number 1 Region: 271-363
Classification Level Classification E-value
Superfamily Immunoglobulin 5.38e-19
Family I set domains 0.051
Further Details:      
 
Domain Number 2 Region: 122-175
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000746
Family TSP-1 type 1 repeat 0.00085
Further Details:      
 
Domain Number 3 Region: 189-246
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.00000235
Family Carboxypeptidase regulatory domain 0.077
Further Details:      
 
Weak hits

Sequence:  ENSOARP00000002721
Domain Number - Region: 453-515
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.00173
Family Carboxypeptidase regulatory domain 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000002721   Gene: ENSOARG00000002563   Transcript: ENSOART00000002775
Sequence length 587
Comment pep:novel scaffold:Oar_v3.1:JH923971.1:830:7058:-1 gene:ENSOARG00000002563 transcript:ENSOART00000002775 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GTPDAEEPTVTAWGLEGSSLRPGQPSPALEDWEEASEWTSWFNVDHPGGDGDFESLAAIR
FYYGPARVCPRPLALEARTTDWALPSDVGERVHLNPTRVFWCLNREQPRGRSCSNYHVRF
RCPLEATWGSWGPWGPCSGSCGPGRRLRRRRCPSPAGDACPGRPSEAQKCVRPRCPGCGP
NTCGCPDHILLGSVVTPSGHPLPGARVSLRDWPGTVATSDAHGTFRMPGVCASSRANVSA
QMDGFSAGMAQAQANSSMSAVATVVLNKLEKPYLVKHPESRVREAGQNVTFCCKASGTPM
PKKYSWFHNGTLLDRRTHRYGAHLELHGLRPDQAGTYHCKAWNDAGAVRSGTARLTVLAP
GQPACDPRPQEHLIKLPDDCGQPGRGPTYLDVGLCPDTLCPSPAGSSPRCGDAGSRCCSV
SRLESRKVHCSGYTLPVKIVAECGCQKCLPLRGLIRGRVVAADSSEPLRFARILLGREPI
GFTSYQGDFTLEVAPSTQRLVMTFVDPSGQFVDTVRVLPFDPRGAGVYHEVKAMRKKAPI
ILDARQSNTISLGEMGEEAPLAAGIIPPGAFRSADGQPYTGAVEAQV
Download sequence
Identical sequences W5NX24
ENSOARP00000002721

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]