SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000002730 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000002730
Domain Number 1 Region: 741-856,1021-1071
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000896
Family FAD/NAD-linked reductases, N-terminal and central domains 0.03
Further Details:      
 
Domain Number 2 Region: 539-645
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.000016
Family N-acetyl transferase, NAT 0.034
Further Details:      
 
Weak hits

Sequence:  ENSOARP00000002730
Domain Number - Region: 259-327
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.000729
Family N-acetyl transferase, NAT 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000002730   Gene: ENSOARG00000002561   Transcript: ENSOART00000002784
Sequence length 1313
Comment pep:known_by_projection chromosome:Oar_v3.1:13:38723037:38973982:1 gene:ENSOARG00000002561 transcript:ENSOART00000002784 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAATAGEPGTTEPSPRARPHRATFRQQAGSRNRKRNWLGRPLTSFPRRDGVNVVSVVT
GLRVLFGAWDSGVAGSKMSVLTSPRGKVEVVHCRRTESQDIYCIKNLIRKFTQKLFGNLN
IIYLLEKANLAITLHNDQEEIMAQATFLDYPNWNIATQDDWVSVFRELDSDIPCTPLNTL
FMHLFVAVDEYSVGCCKEIIRTVFKAVLDLHFVFLIVPSCMSLGSTLITVFSQVGYVPSL
TNDEEFAVHVCHRHNHYPQLHIRKARVEDHDNLMPIFLHHDTILKETYGEYFLAELIEAQ
DEENHAVVCEVEGVAVGFMSVCSQVNLELLHKCFDLGPFHGLCVPHQDDILEPPQEFSIH
ESSDSKLENSGEESQKIVKEPQEAVSLETRESIQRKGTEAAVEEALSPVTSENTGEVEDS
EKLSQVSSMVYMGYYISHRSSLSLSLAEDASSFRPIYKGASTAFCIQLFFIDEKYEARSL
DFMNFVFHLFRDKDFCIISVPHLTPEFVLIQSFVKVVPFNNCTLEQDLYVFHRAGLLKTI
EIRLATLSDTPGVEKLISTLMPCKSILEDLKQYNEARRDPDGTPLQVFVAEVAEQVVGIA
VIRNEMDIEYIRSHYNIEDFIYFNHHQREEHGHLYHFVLNPIFRHYTKFFLKEILRLGYK
SCLYYPVYPQVKEGKVQSPKAHSLTSALHYLVPVRPRRQIVYPLEKLGINAPSKEVSKGT
LSYALNHTNRKLSLEPKITVNAKIVVVGASNVGISFLETLVFCSHLKFSNLTLISTYGLP
GKKLLGNEQRKFLANDHCYNDRDHELMSLCSWVNVVAARMTAIDRAAKQVIVSREKVVLY
DHLILCTGRQYQVPCPTEVDISLHPTNREVSNSCLRRYTGPIPCNHFTLNDEEDCLRALA
WIKNNSITTEGNVIIYGNSIDTYTTVETLLNLGVRGSCIHLVQHPPTSIITCINDCAVEG
AIEEALQAAGVNVYRDALLAQWNNGLYSDPIHTASFTTPAKPFQLPCSMFFSFLEKNVDY
ETFKAFNDACLVYDGRLVIDSNFHTNDIAIRAAGPLTKFSNRYYSNEWTHSNFNSKEIGF
QLAAAMLKLFDPTLEPVTEPPADLDRLIPMYKGAKIKGGILPGSYHYLHVSKPAIPTPLE
VQRAQSDFGSEIVTGNVKNGNYFRIHINKYRMVETITCLSKVPFPASNYIRLFGQHEQAL
NNLCARYEDGLVPDLYSYFTEPWCMALFHDRFIDLRKALHQILSSKEDENLPSMEELARQ
IEDEEINLPEKPRNYLKRVFQETIYRPLVEKSILDYLHYNHYHLPMYAWPGII
Download sequence
Identical sequences W5NX33
XP_014955150.1.66739 ENSOARP00000002730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]