SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000002754 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000002754
Domain Number 1 Region: 4-448,560-615
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.75e-81
Family GDI-like N domain 0.000000000000885
Further Details:      
 
Domain Number 2 Region: 448-559
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.61e-40
Family GDI-like 0.00000126
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000002754   Gene: ENSOARG00000002594   Transcript: ENSOART00000002809
Sequence length 653
Comment pep:known_by_projection chromosome:Oar_v3.1:X:73668241:73911210:-1 gene:ENSOARG00000002594 transcript:ENSOART00000002809 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADNLPSEFDVIVIGTGLPESIIAAACSRSGQRVLHVDSRSYYGGNWASFSFSGLLSWLK
EHQENTDIVNECPAWQEKILENEEAIALSRTDKTIQHVEVFCYASQDLHEDVEEAGALQK
NHASVTSVNCTEAADSACLPIEDESLRTTSCEIPAEQTPSSDPDRALEVNDVQVTGEKEN
HCDDNTCVPSTAEKETSENVPVAEDTAEQPKKNRITYSQIIKEGRRFNIDLVSKLLYSRG
LLIDLLIKSNVSRYAEFKNITRILAFREGRVKQVPCSRADVFNSKQLTMVEKRMLMKFLT
FCMEYEEHPDEYKAYEEIKFSEYLKTQKLTPNLQYFVLHSMAMTSETGSSTIDGLKATKN
FLQCLGRYGNTPFLFPLYGQGELPQCFCRMCAVFGGIYCLRHSVQCLVVDKESGKCKAII
DQYGQRIISKHFLVEDSYLSENTCSHVQYRQISRAVLITDRSVLKTDSDQQISILTVPAE
EPGTFAVRVIELCSSTMTCMKGSYLVHLTCTSSKTAREDLEPVVQKLFTPYTETEIENEE
IEKPRLLWGLYFNMRDSSDVSRNSYNDLPSNVYVCSGPDCALGNDNAVKQAEALFQQICP
NEDFCPPPPNPEDIILDGDNLQPEASESSALPEANSETPKESSNLKNPEEPSK
Download sequence
Identical sequences W5NX57
XP_004022281.1.66739 XP_014944095.1.54773 ENSOARP00000002754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]