SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000002855 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000002855
Domain Number 1 Region: 175-228
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000000768
Family ATI-like 0.014
Further Details:      
 
Weak hits

Sequence:  ENSOARP00000002855
Domain Number - Region: 118-167
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00017
Family TSP-1 type 1 repeat 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000002855   Gene: ENSOARG00000002691   Transcript: ENSOART00000002911
Sequence length 324
Comment pep:novel scaffold:Oar_v3.1:JH923121.1:102:3654:1 gene:ENSOARG00000002691 transcript:ENSOART00000002911 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSVQGWGPGRHGPPGLTALSPVEAETRSAPGSAWPWPLPEGAPPAWAPMPRASAVGCGL
ARRCQTPAPGAPGGPAPLGLASRNASCPCLLAEADPACNSTSLRLDTQACYTGPCLEECV
WSSWSGWGRCSCEVLVQQRYRHQRPAPRGAGAGPPCTRLDGHFRPCLIGNCSEDSCAPPF
EFQACGSPCTGLCATYLSPRLRPPCQPGCYCPEGLLEQAGGCVPPEQCNCQHVSGEGAGV
TLAPGDRLQLGCKECECQRGELQCTSQGCQGLLPLSGWSEWSPCGPCLPLGLLAPASRTA
LEERWPQDTAGLSPTSAPMLASEQ
Download sequence
Identical sequences W5NXF8
ENSOARP00000002855

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]