SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000002894 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000002894
Domain Number 1 Region: 32-208
Classification Level Classification E-value
Superfamily Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 3.27e-58
Family Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 0.0000000159
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000002894   Gene: ENSOARG00000002726   Transcript: ENSOART00000002951
Sequence length 220
Comment pep:known_by_projection chromosome:Oar_v3.1:18:32579001:32598213:-1 gene:ENSOARG00000002726 transcript:ENSOART00000002951 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPNSGRLPGLEATGPHMEPRATCSAAAPLRRQFRVLVGVTGSVAALKLPLLVSKLLDIP
DLEVAVVTTERAKHFYSPRDVPVTLYSDADEWEMWKCRSDPVLHIDLRRWADLMLVAPLD
ANTLGKVASGICDNLLTCVIRAWDRSKPLLFCPAMNTAMWEHPITEQQVGQLKAFGYIEI
PCVAKKLVCGDQGLGAMAEVGTIVDKVKEVLSQHGSSQRS
Download sequence
Identical sequences W5NXJ7
XP_004017893.1.66739 XP_012003359.1.54773 XP_017921861.1.57651 ENSOARP00000002894

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]