SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000002895 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000002895
Domain Number 1 Region: 6-41
Classification Level Classification E-value
Superfamily F-box domain 0.000000183
Family F-box domain 0.0063
Further Details:      
 
Domain Number 2 Region: 97-217
Classification Level Classification E-value
Superfamily RNI-like 0.000000361
Family Rna1p (RanGAP1), N-terminal domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000002895   Gene: ENSOARG00000002730   Transcript: ENSOART00000002953
Sequence length 378
Comment pep:novel chromosome:Oar_v3.1:14:34149168:34150851:1 gene:ENSOARG00000002730 transcript:ENSOART00000002953 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEPGEQLPEEVLVLIFRHLPLPDRAAAARVCRAAAAATCSAVWHDTSISTLPPSCDCEL
EGMLPPYLSACLDHVQNLWLEFEPSRKSSRRAATDLLAALAGRTPGLRGLCLECRGEKPL
FDAGRDVLDAVHALCGAAGALRHLDLRRLPFSLDDALVLQVAHGCPELRSLFLDNRTLVG
SVGPGSVLELLEACPCLRALGLHLASLSRTALEALAAPERAPFELLALRCACPEDARAPP
LPDEAWAALSRRHPGLEVELELEPVLPAESVTRVLQPAVPVAALRLSLSGDTVGPVRFAA
RHYAATLRALEVRAAASAELDAALEELAARCAGLREVHCFCVVRPSVLHAFRARCPRLRS
YTLKLTREPHPWRPTLVA
Download sequence
Identical sequences W5NXJ8
ENSOARP00000002895

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]