SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000002942 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000002942
Domain Number 1 Region: 51-128
Classification Level Classification E-value
Superfamily Ribosomal protein S18 4.58e-26
Family Ribosomal protein S18 0.00078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000002942   Gene: ENSOARG00000002770   Transcript: ENSOART00000003001
Sequence length 143
Comment pep:known_by_projection chromosome:Oar_v3.1:6:97840364:97844967:1 gene:ENSOARG00000002770 transcript:ENSOART00000003001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVVALFGGLGKRKFTRFPTAFVCLTNPCRIAVLWRSCSQYKQVTSSEDLPIPMENPYK
EPLKKCILCEKRVDYKNVQLLSQFISPFTGCIYGRHITGLCGKKQKEITKAIKRAQILGF
MPVTYKDPAYLKDPKVCNIKYRE
Download sequence
Identical sequences W5NXP5
ENSOARP00000002942

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]