SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000003007 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000003007
Domain Number 1 Region: 7-104
Classification Level Classification E-value
Superfamily Histone-fold 2.55e-17
Family Nucleosome core histones 0.00092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000003007   Gene: ENSOARG00000002834   Transcript: ENSOART00000003066
Sequence length 113
Comment pep:novel scaffold:Oar_v3.1:JH922375.1:6:609:1 gene:ENSOARG00000002834 transcript:ENSOART00000003066 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QPAGPCPGASSRPRACRRHALRQAIGALQKGTRLLLRQIPFCRLPREIRVKFSRGVDFSW
QTQALLALQEAAEAFLVRLFEDACLLSLDSRRVRLSSKGAQLARIRGIQGHSW
Download sequence
Identical sequences W5NXW0
ENSOARP00000003007

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]